KEGG   Orientia tsutsugamushi Boryong: OTBS_1950
Entry
OTBS_1950         CDS       T00531                                 
Symbol
virB4
Name
(GenBank) type IV secretion system protein
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
ots  Orientia tsutsugamushi Boryong
Pathway
ots03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ots00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    OTBS_1950 (virB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ots02044]
    OTBS_1950 (virB4)
Enzymes [BR:ots01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OTBS_1950 (virB4)
Secretion system [BR:ots02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   OTBS_1950 (virB4)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 AAA_22 AAA_7 TrwB_AAD_bind AAA_23 ABC_tran ResIII AAA_29 FtsK_SpoIIIE AAA_16 Orbi_VP7 AAA_24 AAA
Other DBs
NCBI-ProteinID: CAM81045
UniProt: A5CFB0
Position
1877046..1879463
AA seq 805 aa
MKFFKTKVAREYYSKREVHVAKFIPYAYHWNKSTIITKKNELIKVIKISGFAFETADDQD
LDIRKRLRNLLFKGMASGSLNLYFHIIRRRKQLASAMDEGDIDPTAGRAKDFVTYVDNEW
KKKYSDFQSFVNDIYITILYKPDVEGGEILKYFYNKLLQKSDKNAWMQSMNEMYANLDEM
VSRVVTTFSDYDAQILKVKNEPNGVFCEILEFLATIVNCGSSMPVLLPRGSIDSYIPTHR
LFFGDRSIEARGAGQRRYAGIVSIQEYGPKTSAGVLDSFLQLPFELIISQSFQFSSRTAA
INKMQLQQNRMIQTEDKAVSQIAEISQALDMATSGEIGFGEHHLTVLCIADSLKALENAL
SIASVEIANTGMQPVREKVNLEAAYWAQLPGNIEYAVRKSVINTLNLAGFASMHNYLPGK
AKGNHWGDSVTVLDTSSGTPFYFNFHVRDVGHTLLIGPTGAGKTVLMNFLCAQAQKFYPR
TFFFDKDRGAEIFIRALDGKYTVINPFQQCNFNPLQLPDTNENRNFLVEWIKTLVTSNGE
SISADDMHYITLAVEGNYKLNPSDRYLSNIVAFLGIGGPDTLAGRIAIWHGTGAKAGIFD
NIHDNMDLQSGRVFGFEMGELLKDPVSLAPVLLYLFHRINLSLDGSPTMIVLDEAWALID
NPVFAPKIKDWLKVLRKLNTFVIFATQSVEDASKSSISDTLIQQTATQIFLPNLKATDIY
RTAFMLSEREFSIIKSTDPGSRYFLIKQGIGSVVAKLNLAGMNNIIGVLSGRVETVILLD
QLRSEYGDDSRKWLPKFYKHLETAK
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgaaattttttaagactaaagtagcaagggagtactactctaagagagaggttcatgtt
gctaaatttattccatatgcttatcattggaataaatctactattattacaaaaaagaat
gagctaattaaggttattaaaattagcgggtttgcttttgaaacagctgatgatcaagat
ctagatattagaaaaaggcttcgaaatcttttatttaaaggtatggcttcaggtagccta
aatttatattttcacataattagacgtcgaaagcagctagcttcagctatggatgaaggt
gacattgatcctactgcaggtagggcaaaagattttgttacttatgttgataatgagtgg
aaaaagaaatattctgattttcagtcttttgtaaatgatatttatatcactattttatat
aaacctgatgttgaaggtggagaaattttaaagtatttttacaataaattattgcaaaag
tctgataaaaatgcatggatgcaaagtatgaatgaaatgtatgctaaccttgatgagatg
gtatcaagagtagtgactacatttagcgattatgatgcacaaatattaaaggttaaaaat
gaacctaatggagttttttgtgagatattggaatttttagctactatagttaattgcggc
agttctatgcctgtacttttacctagagggtcaatagatagttatatacctacacatagg
ttattttttggagatcgttcaattgaagctagaggagcagggcagcgtagatatgctggc
atagttagcattcaagagtatggaccaaaaacttcagctggagtattagattcatttttg
caacttccttttgagcttattattagccaaagttttcagttttctagtcgtacagctgca
attaataaaatgcaattgcaacaaaatagaatgattcaaactgaagataaagcagtatcc
cagattgctgagatttctcaggcattagatatggcgaccagtggtgaaattggttttggc
gaacatcatttaacagtattatgtatagctgatagtttgaaagccttggaaaacgcactt
tctattgcttcagttgaaattgcaaacactggtatgcagccagtacgtgagaaagtgaat
ttagaagctgcttattgggcacaactgccagggaatatagaatatgctgtaagaaaatca
gtaattaatactttaaatcttgcagggtttgcatctatgcataattacctgcctggaaaa
gctaagggaaatcactggggagatagcgttacagtattggatacaagctctggtactccg
ttttactttaactttcacgtacgtgatgttggacatactttattaattgggcctactgga
gctgggaaaacagtgttaatgaattttttatgcgctcaagctcaaaaattttatcctaga
actttcttttttgataaagatagaggtgcagagatttttatcagagctctagatggaaag
tatactgtaattaatccgtttcaacaatgtaattttaatcctttacaattgcctgatact
aatgaaaatcgtaattttttagtagaatggataaaaacgttagttacttcaaatggtgaa
tctattagcgcagacgatatgcattatattacgttagctgtggaagggaattataagctt
aatccatctgatcgttacttaagtaatatagtagcatttttaggaattgggggtcctgat
actctagctggaaggattgcaatatggcatggcacaggtgctaaagctggaatatttgat
aatattcatgataatatggatttgcaaagtggtagagtttttggttttgagatgggtgag
ttattaaaagatcctgttagcttagctccagtattattatatttgtttcaccgtatcaat
ttatcgttggatggttcaccaactatgatagtattagatgaggcatgggctttgattgat
aatcctgtttttgctcctaagattaaagattggttgaaggtattgcgtaagttaaatact
tttgttatatttgctactcagagtgtggaagatgcttcaaagagctcaattagtgatact
ctgattcagcaaactgctactcagatttttttaccaaatttaaaagcaaccgatatctat
agaactgcttttatgttgagtgaaagggaattttctattattaaatccacagatcctggt
tcacggtattttctaataaaacaaggaattggttctgtagtagctaaattaaatttagct
ggcatgaataatatcataggagtgctctcaggccgagttgaaactgtaatattattagat
cagttaagaagcgaatatggagatgattctagaaaatggttgcctaaattttataagcac
ttagaaacagcgaaataa

DBGET integrated database retrieval system