KEGG   Pseudomonas aeruginosa LESB58: PLES_26671
Entry
PLES_26671        CDS       T00818                                 
Name
(GenBank) conserved hypothetical protein
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Other DBs
NCBI-ProteinID: CAW27392
Position
complement(2865267..2867456)
AA seq 729 aa
MSGKQPVEVLLRPAVELYTVAACAGAAFLCLVAPWSLALSPAMGIGSALAFGAYGAIRYR
DARIILRYRRNIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYV
EPTPAYRLTRRLEERLEFAPLPLSRLPKLTGWDAPFNPVRPLPPVGGLPRLHGIEPDEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRRNAAGEHEVVIVIDPKGDADLLKR
MYVEAQRAGREGEFYIFHLGWPEISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREF
AWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAY
TQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGAT
DSSDIRGATDFTSNTQDRISMASVPMIEPSHVVGLPKGQCFALLQGGQLWKVRMPLPAPD
PDEVMPTDLQQLAGYMRQSYSEATQWWEFTSSAALPHAALPDDLLDDAAPAEPDAVATGA
DDSTGEAAP
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtcgggcaaacagccggtcgaggttctgctacgcccagcggtggagctatacaccgtc
gcggcgtgtgcaggcgccgcgtttctgtgcctggtggccccatggtcgctcgcgctgagc
ccggccatgggcatcggcagcgccttggcgttcggcgcctacggcgcgatccgctaccgc
gatgcccgcatcatcctgcgctaccggcgcaacatccgccgtctgccgcgttacgtgatg
accagcaaggacgtgccggtcagccagcagcgcctattcgtggggcgcggctttctctgg
gagcagaagcacacgcatcggctgatgcagacgtaccggcccgagttccgccgctacgtc
gagccgacgccggcctaccggctgaccaggcgcctggaggaacggctggagttcgcgcca
ttgccgctctcgcgcctgccgaagctcaccggctgggacgcgcctttcaaccccgtgcgc
ccgttgccgcctgtcggcggcctgccaaggctgcacggcatcgagcccgacgaagtggac
gtcagcctgccgctgggcgagcgcgtcgggcactcgctggtgctgggcaccacgcgggtg
ggcaagacgcgcctggccgagttgttcgtcacgcaggacatccgtcgcaggaatgctgcc
ggcgagcatgaggtcgtcatcgtcatcgaccccaagggggatgccgatctcttgaaacgg
atgtacgtcgaagcccagcgcgctggccgcgaaggcgagttctacatcttccacttgggc
tggccggaaatcagcgcccgctacaacgccgtgggccgcttcggtcggatctcggaagtg
gcgacacgcatcgcggggcagctctccggcgaaggcaacagcgcggcgttccgcgagttc
gcatggcgcttcgtgaacatcatcgcccgcgccctggtggaactggggcagcgcccggac
tacatgctgatccagcgccacgtcatcaacatcgacgcgctgttcattgagtacgcccag
cactactttgccaagacggagcccaaggcctgggaggtgatcgtccagatcgaggccaag
ctcaacgagaagaacatcccaaggaacatgatcgggcgcgagaagcgtgtggtggcgctg
gagcaatacctctcccaggcgcgcaactacgaccctgtgctcgatggcctgcgctcggcg
gtgcgctacgacaagacctacttcgacaagatcgttgcatcgctgctgccgctgctggaa
aagctcacgagcggcaagatcgcccagctcctggcgccgaactactccgacctggccgac
ccgcgcccgatcttcgactggatgcaggtgatcaggaagcgcgccgtcgtctatgtcggc
ttggacgcgctgtccgatgcggaggtcgccgcagcggtcggcaactcgatgttcagcgat
ctcgtctcggtggctgggcacatctacaagcacggaatcgacgatggcctgccgggcgca
tcggctggtgcgcgcgtgccgatcaacgtgcatgcggacgagttcaatgaattgatgggt
gacgagttcattccgctcatcaacaagggcggtggcgcgggcctgcaagtcaccgcctac
acgcaaacgctttcggacatcgaggcccgcatcggcaaccgcgcgaaggccggccaagtg
atcgggaatttcaacaatttattcatgttgcgcgtgcgcgagacggccaccgcggaactg
ctgacgaggcagttgccgaaggtcgaggtctatacgaccaccatcgtctcgggcgcgacg
gacagctcagacatccgcggcgcgacggacttcacgtcgaacacccaggaccgcatcagc
atggccagcgtgccgatgatcgagccgtcacacgtcgtcggtctgcccaagggccaatgc
ttcgcgctgctgcagggcggccagctttggaaggtgcgcatgccgcttccggcgccagac
cccgatgaagtgatgccgacggacttgcagcaactggccgggtatatgcgccagagctac
agcgaggccacgcagtggtgggagttcaccagttccgcagccttgccgcatgcagccttg
cccgacgacctgctggatgacgccgctccagccgagcctgacgcggtggccaccggcgcc
gacgacagcaccggcgaggccgcaccatga

DBGET integrated database retrieval system