KEGG   Parvularcula bermudensis: PB2503_00582
Entry
PB2503_00582      CDS       T01298                                 
Name
(GenBank) TraD
Organism
pbr  Parvularcula bermudensis
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 cobW
Other DBs
NCBI-ProteinID: ADM08197
UniProt: E0TAY8
Position
8800..10839
AA seq 679 aa
MSGNASGPFKTFLRGGQVTLHTLRMFGQVMRFLSFAMVSLMLVIAWAGVMVNTAPEDRHY
AMKRYEAWAYRAAGFRESLELNMRTADGSHAPFPIGTILTHPAVAEHEKRFRRQLFVWGR
IGGLGGGFGFLLLTGLFVGRGSTLTRTNVKRGAAMASAQELKAQIGAHNRWTAMKRKELR
GRPRYALAGIPYPVGSEVQHTGISGTIGSGKTQAIAALLDQIRKAGDRAVVFDLTGGFIA
PFYREDRDTILNPLDRRAPAWSVFDEAKTKAGFDAIAAAMIPRAQKADPVWADSARMVFS
TAGQLLLGDGRASNKELVDLLLNAELRTLAPFFAGTPAASIISADTPRMTNSVRMMLSTY
LDGLRLLPSRGDRFSITEWIENDRAGSTLFLSSRADMHETLRPLLTVWMDTAVRALMSRP
RDPNRRIWFIMDEVAALQELPSIMDGLARGRQFGAAFVLGIQAQSQLRDIYGPDGAQTLS
SVCRTKLILAASDADTAKWYADFLGRQETSRSNENVSFGANTIRDGVMLARQERIEHLVI
PEEIMNLRSLEGYLKMPEGFPLAKVKVPLVLREDREPAFLPREDQGLLITRARAPHTVKA
MQATAHRPGSEDGQRDMFSEAERDGIDELIDPDTGEVSATTRVEGVAQDGAEGADPPSPP
DRPRPRDIGQDFPDWGFEP
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgagcgggaacgcatcgggccccttcaagaccttcctgcgcggcgggcaggtcaccctc
cacacgctccgcatgttcggtcaggtcatgcggtttctgagcttcgccatggtctcgctg
atgctggtcatcgcttgggcgggcgtcatggtgaacaccgcgcccgaggaccgccattat
gcgatgaagcgatatgaggcctgggcgtaccgggccgccgggttccgagagagcctcgag
ctcaacatgcggacagcggacgggagccatgcgcccttccccatcggcaccatcctcacc
catccggccgtggccgagcatgagaaacggttccgccgtcagctcttcgtctgggggcgg
atcggcgggcttggcgggggcttcggtttcctccttctgaccggccttttcgttggccgg
ggcagcaccctgacccgcaccaatgtcaaacgcggcgccgccatggcgtccgcgcaggag
ctcaaggcgcagatcggtgcccacaaccgctggaccgcgatgaagcggaaagagctccgg
gggcggccccgctatgcccttgccggcatcccctatccggtcggttcggaggtccagcat
acggggatctccggcaccatcggttcgggcaagacccaggcgatcgccgcccttctcgac
cagatccgcaaggccggtgaccgagccgtggtgttcgacctgaccggcgggttcatcgcg
cccttctaccgcgaggatcgcgacaccattctcaacccgctcgaccggcgggcccccgcc
tggtcggtgttcgacgaggcgaagaccaaggcggggttcgacgccatcgcagcggccatg
atcccccgggcccagaaggccgatccggtctgggccgactcggcgcggatggtgttctcc
accgccggtcagcttctcctgggggacggccgggcgagtaacaaggagctcgtcgatctc
ctgctgaatgcggaactcaggacgctggcgcccttcttcgccgggacccccgcggcgtcg
atcatctcggcagacacgccgcgcatgaccaattccgtgcggatgatgctgtcgacctat
ctcgacggcttgcggctcctcccgagccggggcgaccgcttttcgatcaccgagtggatc
gagaacgaccgcgcggggtcgaccctcttcctctcctcaagagcggacatgcacgagacc
ctgaggccgcttctcaccgtctggatggacacggccgtcagagcgctgatgtcccgaccg
cgcgacccgaacaggcggatctggttcatcatggacgaggtcgccgcgctccaggagctt
ccctccatcatggacgggttggcgcggggccgtcagttcggggcagctttcgtcctcggc
atccaggcgcaatcgcagctcagggacatttacgggcccgacggcgcgcagaccctttcc
tcggtctgccggaccaagttgatcctcgccgcctccgacgccgacaccgccaaatggtat
gcggactttctcgggcggcaggagacctcccgctccaacgagaatgtctccttcggcgcg
aacaccatccgggacggggtcatgctggcccggcaggagcggatcgagcatctcgtcata
cccgaagagatcatgaatctccgttctctcgagggctatctcaagatgcccgagggcttc
cccctggcgaaggtgaaggtgccgctggtcctgcgcgaagaccgggaaccggctttcctg
ccgcgagaggatcagggcctcctcatcacccgggcgcgggcgccgcacacggtcaaagcc
atgcaggccaccgcgcaccgacctggcagcgaggatggccagcgggacatgttcagcgag
gccgaacgggacggcatcgacgagttgatcgatcccgacaccggcgaggtgtcggcgacg
acgcgagtggaaggcgtggcgcaggacggggccgaaggggccgatcccccctcaccgccc
gatcgtccacgcccccgtgacatcggccaggactttcccgattgggggtttgagccctga

DBGET integrated database retrieval system