KEGG   Parvularcula bermudensis: PB2503_05712
Entry
PB2503_05712      CDS       T01298                                 
Name
(GenBank) conjugal transfer protein trbe
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PB2503_05712
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_05712
Enzymes [BR:pbr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PB2503_05712
Secretion system [BR:pbr02044]
 Type IV secretion system
  Trb secretion system protein
   PB2503_05712
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 AAA_16 AAA_22 HerA_C ABC_tran TraG-D_C NACHT DUF87 AAA_30 FtsK_SpoIIIE AAA_29 AAA_25 AAA_7
Other DBs
NCBI-ProteinID: ADM09214
UniProt: E0TGX4
Position
1090805..1093276
AA seq 823 aa
MLNLKEYADTPKLLADYLPWACIVAPGVVLNKDGSFQTTFRYRGPDLESSTEEELVSVMA
RVNNVLRRFGSGWALFFEAQRHEVHDYPESDFPDALTWLIDQERGLQAEESGARFESAYY
LTLLWLPPADATGRAEKALIQRAETEDAATWRHRLETFQQHADRVFDLLATCLSEIAKLS
DDETLTYLHSTISTKRHPVVTPELPVFLDAVLADEPFAGGLEPMIGDAHLRTLTILGFPS
STLPGILDELNRQGFAYRWATRFIAMDKSEAEKVLGKKRRYWFAKRKSIGAVLRETMFNE
QAALVDNDADNKAADADAALQELGSDLVSYGYVTTTITVADPDRRTVDEHIRIAERIVNG
RGFTAIKETLNAVDAWLGSLPGHPYANVRQPILHTLNLAHMVPLSAVWAGEETNRHLQAP
ALIQAQTDGTTPFRLNLHIGDVGHTLVVGPTGAGKSVLLSLLALQWKRYEGAQVFIFDKG
RSARAATLAMGGAHVDLGSSNAPSLQPLKDIDTEHGASFAADWLAGLCTNEGVAMTPDLK
ARLWEAIQSLASAPEAERTLTGLTLMLQDETLKSALHPFTLEGPHGRLLDADSESLTLAD
TVCFEMEELMHAKGAVAPVITYLFQRLEERFDGRPTLLILDEAWLFLDDPMFAARIREWL
KTLRKKNVSVVFATQSLADIANSSIAPALVESCPTRIFLPNERAQEPQSKEIYQRFGLNA
RQIELISRATPKRDYYYQSPLGARVFDLGLGPIALSVCGASSPEDQARMDRIWAETEGDG
FAACWLIEKGLPWAADLLIRWPGHAAEPEAHAPFNPSHILAAE
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgctgaatctcaaagaatatgccgataccccaaaactgctcgcggactatctcccatgg
gcctgcatcgtcgcgccgggtgttgttctcaacaaggacggatcgtttcagacgacattc
cgctatcgcggcccggacctcgaaagctccacggaagaagaacttgtatccgtcatggcg
cgggtgaacaatgtgttgcgcaggttcggctccggctgggcgctcttcttcgaggcgcag
cgccatgaagtgcatgactatcccgaaagcgatttcccggatgcgctgacctggctgatc
gatcaggaacgcgggttacaggcagaggaaagcggtgcccgctttgaaagtgcctactat
ctgacactgctctggctgccgcctgcagacgcgacgggccgcgccgagaaggccctcatc
caacgcgccgagacagaagatgccgccacctggcgacaccggctggagaccttccagcaa
cacgccgaccgcgtcttcgacctcctcgcgacctgcctctcagaaatcgctaagctctcc
gacgacgagacgctgacctatctccactcaacgatttcgaccaagcgccatccggtggtg
acaccagaactgccggtctttctcgatgcggtgctcgctgatgagcctttcgcgggcggg
ctggagcccatgatcggtgacgcgcatctcagaacgttgaccattctcggatttccgtcc
tcaacgctccccggcattctcgatgagctgaaccgtcagggctttgcctatcgctgggcg
acccggttcatcgcgatggacaaatcagaagccgaaaaagtgctcggcaaaaagcgccgt
tactggtttgccaagcgcaaatccatcggtgcggtcctgcgcgagaccatgttcaatgaa
caggcagccctcgtcgacaacgacgcagacaacaaggcggccgatgccgatgcggccctg
caggagctcggaagcgatctcgtttcctacggttacgttacaactacgatcaccgtcgcc
gatcccgaccgccgcaccgtggatgagcatatccggatcgccgagcgcatcgtaaatggc
cgtggctttacagcgatcaaggaaaccctcaacgccgtcgatgcctggctcggaagcctt
cccggtcatccttatgccaatgtccgccagcccatcctgcatacgctgaaccttgcccat
atggttccgctctcggcggtctgggcgggtgaagagacgaaccggcacttgcaagccccc
gcgcttattcaggcgcagaccgatgggacgaccccgttccggctgaacctgcatattggc
gatgttggccacacgctcgtcgtcgggccgacgggtgctggcaagtccgtgctcctgtcg
ctgctcgcgctgcaatggaaacgctatgagggcgcgcaggtttttatcttcgacaagggg
cggtcagctcgcgcggcaacgctcgccatgggcggcgcgcatgtcgatcttggcagttca
aacgccccgagcctccagccgctgaaagacatcgacaccgaacacggcgcgagctttgcc
gcagactggctggctggtctttgcacaaatgaaggcgtcgccatgacgccggacctcaag
gcaaggctatgggaagcgattcagtcgcttgccagcgcgccggaagccgagcgtacccta
accggtctcacgctgatgctgcaggacgagacactcaaatcggcgttgcacccgttcacg
ctggaaggcccgcatggacggctcctcgatgccgactccgaaagcctgaccctcgccgac
accgtctgttttgagatggaagagctgatgcacgccaagggtgcggtggccccagtcatc
acctatctcttccaacggctggaggaacggttcgatggcagaccgacactcctcatcctg
gatgaagcctggctgttccttgatgatcccatgttcgcagcccgcattcgcgagtggctg
aaaaccctacgcaagaaaaacgtgtccgtcgtgttcgccacgcagagcctggccgacatc
gcgaactcaagcatcgcccccgcactggtcgagagctgccccacacgcatctttctgccg
aatgaacgcgcgcaggaaccgcagtccaaagagatctatcagcgcttcggcctcaacgct
cgccagatcgagctgatcagccgggccacaccgaagcgcgactattactaccagtcgccc
ctcggcgcgcgcgtcttcgatctcggcctcggcccgatcgcgctatcagtctgcggtgcc
tcctcccccgaagatcaggcccgcatggatcgcatctgggcggagacggaaggtgacggg
ttcgccgcctgctggctgatcgagaaaggcctgccctgggcggccgacctgctcatccgc
tggcccggccatgcggcggagcccgaagcgcacgcgcccttcaatccttcccacatcctc
gccgccgaatag

DBGET integrated database retrieval system