KEGG   Parvularcula bermudensis: PB2503_12579
Entry
PB2503_12579      CDS       T01298                                 
Name
(GenBank) conjugal transfer protein traB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PB2503_12579
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_12579
Enzymes [BR:pbr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PB2503_12579
Secretion system [BR:pbr02044]
 Type IV secretion system
  Trb secretion system protein
   PB2503_12579
SSDB
Motif
Pfam: T2SSE Dynamin_N FtsK_SpoIIIE Zeta_toxin AAA_28 AAA_16 Septin MMR_HSR1 TrwB_AAD_bind AAA_24 Pox_A32
Other DBs
NCBI-ProteinID: ADM10554
UniProt: E0TFJ4
Position
2561727..2562707
AA seq 326 aa
MSALPQPSETETRRTAMLRTAFDGPVGAALAAPDTIEILANPDGSVWVEKAGFGLRRASE
TLGRAERERIIRLVASSVGEVCDRASPIVSAELPGSGERFEGILPPVSEAPCFAIRKPAG
QPIALDTYVETGALTPALCVGLRQALEDRLNIVVAGGTSSGKTTFANALLSEPALAEDRI
VILEDTRELRCSAENVTQLRTHRSGITLRDLVRSTMRLRPDRIIVGEVRGGEALDLLKAW
NTGHPGGITTLHANSASGALTRLEQLVEEATTALPHALIGEAVDVIVFMSRASGARRVEQ
ALRITGFDGTEYRTEPLAAPFLNIVN
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtctgccctgccccagcccagcgagaccgagacccgccgtacagctatgctccgcacg
gccttcgacggtccagttggggcagcgctggcggcgcctgacacgatcgagatcctcgcc
aatcctgacggctcggtctgggtcgagaaggcaggtttcggattgcgccgggcatccgag
acgctgggccgtgccgagcgcgagcggatcatccggctggtcgcgtcctccgtcggtgag
gtctgcgaccgggcgtctccgattgtgtcggccgaactgcctggctccggcgagcggttc
gaaggcatcctgccgcccgtttccgaggcgccctgctttgcgatccgcaagccggcaggc
caaccgatcgcgctggatacctatgtcgaaacaggcgcgctgacgccggcgctttgtgtc
gggcttcggcaggcacttgaagaccggctcaacattgttgttgcgggcggcacgtcatcg
ggcaagacgacctttgccaatgcattgctgtccgaaccggccttggctgaagaccggatc
gtcattctggaagacacgcgcgagctccgctgctccgccgaaaatgtgacgcagctcagg
acgcatcggtccggcatcacgcttcgcgatcttgtccgctccaccatgcggcttcggcct
gaccggatcattgtcggcgaggtccgcggcggcgaagccctcgacctcctcaaggcctgg
aataccggccatccgggcgggatcaccacgctgcatgcgaattccgcctccggcgcactg
acccggctcgaacagctggtcgaggaagcaacgaccgcccttccccatgccctgatcggc
gaggcggtcgatgtgatcgtcttcatgtcccgcgcaagcggcgcccgccgcgtcgagcag
gcgctccggattaccggctttgacggcactgaataccggaccgagccgctcgccgccccc
tttctcaacatcgtcaattaa

DBGET integrated database retrieval system