KEGG   Physeter catodon (sperm whale): 102976185
Entry
102976185         CDS       T06011                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X3
  KO
K04462  ecotropic virus integration site 1 protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad05200  Pathways in cancer
pcad05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102976185 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976185 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102976185 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102976185 (MECOM)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    102976185 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 102976185
NCBI-ProteinID: XP_007101640
UniProt: A0A2Y9EFH5
Position
1
AA seq 1203 aa
MPDADGVASTLSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMP
GAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDPSYGWEILDEFCNVKFCIDASQPDVGSWL
KYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHDTMAPDIHEERQ
YRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLASENDLREIHAIQECKEC
DQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKQV
FTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQ
FSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPG
TPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIP
ASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPPVGDNKPVELQPERSSEE
RPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESDKEKCKENGKMFKDKVSPLP
NLASIHNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSAGLVGLQDKKVG
ALPYPSMFPLPFFPAFSQSMYPFPDRDLRALPLKMEPQSPSEVKKLQKGSSESPFDLTTK
RKDEKPLTPVPAKPPVTPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGEKKGGNGEP
RPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQMSAIENMA
EKLESFSALKPEASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANL
TRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRH
LKKHENGNMSGTATSSPHSELESTGAILDDKEDAYFTEIRNFIGNSNHSGQSPRTTEERM
NGSHFKDEKALVTSQNSDLLDDEEVEDEVLLDEEDEDNDITGKTGKEPGTSNLHEGNHED
DYEDTSALEMSCKTSPMRYKEEEYKTGLSALDHIRHFTDSLKMRKMEDNQYIEAEVSSFS
ASHVPEELKQPLHRKSKSQAYAMMLSLSDKETLHSSSHNSSNVWHSMARAAAESSAIQSI
SHV
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgccagatgcagatggagtagccagcactctctccctcaatattcaagagccatgctct
ccagctacatccagcgaagcattcactccgaaggagggctctccttacaaagcccccatc
tacatccctgatgatatccccattcctgctgagtttgaacttcgagagtcaaatatgcct
ggagcaggccttggaatatggaccaaaaggaaaattgaagcaggtgaaaagtttgggcct
tatgtaggagaacagaggtcaaacctgaaagaccccagttatggatgggagatcttagat
gagttttgcaatgtgaagttctgcatagatgctagtcaaccagatgtaggaagctggctc
aagtacatcaggttcgctggctgttatgatcagcacaacctcgttgcatgccagataaat
gatcagatattttatagagtagttgcagacattgcaccaggagaggagctcctgctgttc
atgaaaagtgaagactatccccatgacactatggcaccggatatccacgaagaacggcaa
taccgctgtgaggactgtgaccagctcttcgagtccaaggctgaactagcggatcaccag
aagttcccatgcagcacaccccactcggcattctcaatggtagaggaggactttcagcaa
aaactcgcgagtgaaaatgatctccgagagatacatgcaattcaggagtgtaaggaatgt
gaccaagtgtttcccgatttgcaaagcctggagaaacacatgttgtcacatactgaagag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaatccgc
caccagatgtcacatgacagtggaaagcactatgaatgtgagaactgtgccaagcaggtt
ttcacggaccctagcaaccttcagcggcacatccgctctcagcatgttggtgcccgggcc
cacgcatgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaacacaag
cacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgct
gactattttggcgccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacct
gccagttctcctgttaaaggactgtcaagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaa
cacccacctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagag
aggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacg
ccaagtggcagtgacctggaaaccacctcgggctctgatctggaaagtgacattgaaagt
gataaagagaaatgtaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttccg
aatctggcttcaatacataataagaaagaatacagcaatcattccattttctcaccatct
ttagaggagcagactgcggtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgagaaatactttggttcagcaggactggtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccgttttttccagcattctctcaatcaatg
tacccatttcctgatagagacttgagagcgttacctttgaaaatggaaccccagtcacca
agtgaagtaaagaaactgcagaagggcagctctgagtctccctttgatctcaccactaaa
cgcaaggacgagaagcccttgaccccagtacccgccaagcctccagtgacgccggccaca
agccaagaccaacccctggatctaagtatgggtagtaggagtagagccagtggcaccaag
ctgacagagcctcgtaaaaaccacgtgtttggggaaaagaaaggaggcaacggtgaacca
agaccagcatctgatggttccttacagcatgctagacccactcctttcttcatggaccct
atttacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagagaaatac
ttgagaccttctccaggattcttatttcacccgcaaatgtcagctattgaaaacatggcg
gagaagctggagagcttcagtgccctgaaacctgaggccagtgaacttctacagtcggtt
ccctccatgttcaacttcagagctcctcctaacgccctgccagagaacctcctgcggaaa
ggaaaggaacgctatacctgcagatactgtggcaagatttttccaagatctgcgaaccta
acacggcacttgagaacccacacaggagagcagccttacagatgcaagtactgcgacagg
tcattcagcatatcttctaacctgcagcggcatgttcgcaacatccacaataaggagaag
ccctttaagtgtcacttatgtgataggtgttttggtcaacaaaccaacttagacagacac
ctaaagaagcatgagaatgggaacatgtctggtacggccacatcgtcgcctcattctgaa
ctggaaagtacaggtgcgattctcgatgacaaggaagatgcttacttcacagaaattcga
aatttcatcgggaatagcaaccatagcggccagtctcccaggaccacagaagagagaatg
aatggcagtcactttaaagatgaaaaggctttggtgaccagtcaaaattcagacttactg
gatgatgaagaggtggaagacgaggtgttgctagatgaggaggatgaagacaatgatatt
actgggaaaacaggaaaggaaccagggacaagtaatttacatgaaggaaaccatgaggat
gactatgaagacaccagcgccctggagatgagttgcaagacgtccccaatgaggtataaa
gaggaagaatataaaactggactttctgctctagatcatataaggcacttcacagatagc
ctcaaaatgaggaaaatggaagataatcaatatattgaagctgaggtgtcttctttcagt
gcttcccatgtgccagaggaacttaaacagccgttacacagaaagtccaaatcacaggca
tatgctatgatgttgtcattgtccgacaaggagaccctccattcttcatcccacaattct
tccaacgtgtggcacagtatggccagggctgcggcagaatccagtgctatccagtccata
agccacgtatga

DBGET integrated database retrieval system