KEGG   Phascolarctos cinereus (koala): 110203730
Entry
110203730         CDS       T05867                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw05200  Pathways in cancer
pcw05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110203730 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110203730 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110203730 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110203730 (MECOM)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    110203730 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-BED zf-C2H2_11 zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 110203730
NCBI-ProteinID: XP_020835855
Position
Unknown
AA seq 1238 aa
MRSKGRARKLATSDECLYETYPEIPLEEMPEVDGEVGTLSLSIQEPASPATSCEEFTPKE
GSPYKAPIYIPDDIPIPPEFELRESNVPGSGLGIWTKRKIEVGEKFGPYIGEQCSDLKDP
SYGWEILDEFCNVKYYIDASQPDVGSWLKYVKFAGCYEQHNLVACQINDQIFYRVVTDIE
PGEELLLYMKSEEYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFS
MVEEDFQPKLDSESDLREMQEIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFAT
SSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSS
LNKHRRFCEGKNHFAAGGFFGQGISLPGTPALDKTSMVNMNHGNPGLADYFGANRHSAGL
TFPTAPGFSFNFPGLFPSGLYHRPPLIPASSPVKGLPSTERNKSQSPLMTHPQILPATQD
ILKALSKHPPVGENKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDLESDKEKFKENGKMFKDRVSPLQSLAAINNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRELRPLPL
KMEPQSPGDGKKVQKGSPESPFDLTTKRKEEKSVTPATSKPAATPLTSQDQPLDLSMGSR
SRASGTKSTEPRKNHVFGEKKGGGIDQRKVSDASLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLDSFSALKPEGNELIQSVPSMF
NFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDSYFTEIRNFIGNSNHSHQSPRNAEERMNGSHFQDDKILVAGQNSDLLDDEE
ADDEVLLDEEDEESDMTGKPGKEPISSNLHEGNPEDNYEETSALEMNCKTSPSRYKEEEY
KSGLSALDHIRYFTDSLKMRKMDETHYNEAELSCSASHLPEDLKQPLYRKSKSQAYAMML
SLSDKDSLHSPSHGSPNVWHSMARAAAESSAIQSLSHV
NT seq 3717 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtgatgaatgtttatatgaaacc
taccctgagatccctctagaagaaatgcctgaagtagatggagaagtaggcaccctttct
ctcagcatccaagaaccagcttctcctgcaacatcctgtgaagaattcactccaaaggag
ggctctccttacaaagcccccatttacattcctgatgacatccccattcctcctgagttt
gaactccgagagtcaaatgtgcctggatcaggattaggaatatggaccaaaagaaagatt
gaagttggagaaaaatttgggccatacattggagagcagtgctcagaccttaaagatccc
agctatgggtgggagatattagatgagttttgcaatgtgaaatactacatagatgccagt
caaccagatgtcgggagctggctcaagtatgtcaagtttgctggatgctatgaacagcac
aacctcgttgcatgccagataaatgatcagatattttatagggtagtcacagacattgaa
cccggagaggagctcttactgtacatgaagagtgaagagtactcccatgaaacaatggcg
cccgacattcatgaagagcgtcagtaccgctgtgaggactgtgaccagctcttcgaatcc
aaagccgagctagtggatcaccagaagttcccctgcagcacccctcactcggcattttcc
atggtggaagaggactttcagccaaagctggacagtgagagtgacctccgggagatgcag
gaaatccaggagtgtaaagagtgtgaccaagtcttcccagatttgcaaagcctggagaaa
cacatgttgtcacatacggaagagagagaatacaagtgtgatcagtgtcccaaggctttt
aactggaagtccaacttaattcgccaccagatgtcacatgatagcggaaagcactatgaa
tgtgagaattgtgccaagcaggttttcacggaccctagcaacctacagaggcacattcgc
tcccagcatgtcggagcccgggcccacgcatgccctgagtgtggcaaaacatttgccacg
tcgtccggcctcaaacaacacaagcacatccacagcagtgtgaagcccttcatctgtgag
gtctgccataagtcctatacccagttttcaaatctttgtcgtcataagcgcatgcatgct
gattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacatcttcc
ttaaataagcacaggaggttttgtgagggcaagaaccattttgcagcaggtggatttttt
ggccaaggcatttcacttcctgggaccccagctctggataaaacatccatggttaatatg
aaccatggcaatccgggccttgctgactattttggtgccaataggcattctgctggtctt
acctttccaacagctcctggattttcttttaactttcccggtttgtttccttctggcttg
taccacaggccgcccttgatacctgctagctctcctgttaaaggactgccgagtactgag
cgaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacccaggat
attttgaaggcactaagtaaacacccccctgtaggggaaaataagccagtggagctccag
cctgagaggtcctctgaagagaggcccctggaaaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtaccccaagtggcagtgacctggaaaccacttctggctctgat
ctcgaaagtgaccttgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaa
gacagagtaagccctctgcagagtttggctgcaataaataataagaaagaatacagcaat
cattccattttctcaccatctttagaggagcaaacggcggtgtcgggagctgtgaacgat
tctataaaagctattgcgtctattgctgaaaaatacttcggttccacaggactggtgggg
ctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccatttttt
ccagcattctctcagtcaatgtacccatttcctgacagagagttgagaccgttgcctttg
aaaatggagccccagtcaccaggcgatgggaagaaagtccagaagggtagccctgagtct
ccctttgacctcaccaccaaaaggaaggaggagaaatctgtgactccggccacctccaaa
ccagcagcaacgcctctcacgagccaggatcagcccctggacctgagcatgggtagtcgg
agccgagctagtgggacgaagtcgactgagcctcggaagaaccatgtttttggcgaaaag
aaaggaggcggcattgaccaaaggaaggtttcggatgcctctttgcagcatgccagacca
actcctttctttatggatcccatttacagggtagagaagagaaagctcactgacccactt
gaagctttaaaagagaaatacttgagaccttctccaggattcttatttcatccacaattc
caactgcctgatcagagaacttggatgtccgccatcgaaaacatggctgaaaagctggac
agcttcagtgctctgaaaccagaaggcaatgagctcatccaatcagttccctccatgttc
aacttcagagcccctccaaacgctctgcccgagaacttgcttcggaagggcaaggaacgg
tatacttgcagatattgtggcaagattttcccaagatcagcaaacctaacacgtcactta
aggacgcacactggagagcagccatacagatgcaaatactgcgatcgatccttcagcata
tcttccaacttacagcgacatgtgcgaaacattcacaataaggagaaacctttcaagtgt
cacttgtgtgaccggtgttttggccagcaaaccaacctagacagacacctaaagaaacac
gagaatgggaacatgtctggtactgcgacatcatcgcctcattctgaactggaaagcaca
ggtgccatcttggatgacaaagaggattcctacttcacagaaattcgaaatttcattgga
aacagcaaccatagtcaccaatcaccaaggaatgcagaggagagaatgaatggaagccac
tttcaggatgataagatcctggtggctggacaaaattcagacttgctagatgatgaagaa
gcagatgatgaagtattgttggatgaagaagatgaagaaagtgacatgacggggaaacca
ggaaaggagccaatttcaagtaatctgcatgaaggaaaccccgaggacaactatgaagaa
accagtgctctggaaatgaactgtaagacgtccccaagcaggtataaagaggaggagtat
aaaagtggactttctgctttagatcatataagatacttcacagatagcctcaaaatgagg
aaaatggacgagactcactataatgaagctgagctgtcttgtagcgcttctcacctgcca
gaggaccttaaacagccgctatacagaaagtccaagtcacaggcctatgctatgatgttg
tcactgtctgacaaggactcccttcattctccatctcatggttctcccaacgtgtggcac
agcatggccagggctgccgcggaatcaagtgccatccaatctctcagccacgtatga

DBGET integrated database retrieval system