KEGG   Clostridioides difficile 630: CDIF630_01470
Entry
CDIF630_01470     CDS       T03885                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
pdc  Clostridioides difficile 630
Brite
KEGG Orthology (KO) [BR:pdc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pdc03016]
    CDIF630_01470 (truB)
Enzymes [BR:pdc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     CDIF630_01470 (truB)
Transfer RNA biogenesis [BR:pdc03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    CDIF630_01470 (truB)
 Prokaryotic type
    CDIF630_01470 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 DUF4318
Other DBs
NCBI-ProteinID: AJP11012
UniProt: Q18BH7
Position
1508371..1509276
AA seq 301 aa
MNKIISILKPTGMTSHDVVSRVRKILNIKKVGHTGTLDPDASGVLPICIGKATKVCEVIL
NKDKSYICELTLGISTDTYDASGEILKKVDDFKFSNEDIERAFDTQRGEINQLPPIYSAL
KVNGKRMCDLVRSGRQSEITLKTRRVNIKDIKILSIKGNKVMFYVECSKGTYVRSICHDI
GEYLGCGAHMSFLNRTSSGKFDLDNSITLEELELFYENKTLDKYLYDIDYVLDSFNYVVL
NPNAIKYYSNGGSIDDKRFLKNNFDKDDEFVRVYSTDNFLGLGKLSKHNNTISVKSDKMF
I
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaataagattataagtatattgaaacccacaggtatgacatctcatgatgttgtaagt
agagtgagaaagattttaaatataaaaaaagttggtcatacaggtactcttgacccagat
gcttcaggtgttttaccaatctgtatagggaaagctacaaaagtatgtgaagttatttta
aacaaagataaatcgtatatatgtgagcttactttaggtataagtacagatacttatgat
gcttcaggtgaaattttaaaaaaagttgatgattttaaatttagtaatgaagacatagaa
agagcttttgacacacaaagaggagagataaatcaacttcctccaatttattcagcttta
aaggtaaatggaaagagaatgtgtgatttagtaagaagtggtagacaatctgaaattact
ttaaaaacaagaagagtaaatataaaagacataaaaatactaagtataaaaggtaataaa
gtaatgttttatgttgagtgttctaaagggacttatgtgagaagcatttgccatgatata
ggagaatatctaggttgtggagctcatatgtcgtttttgaatagaacatcttctggtaaa
tttgacttagataattcaataacattagaagaattagaattattttatgaaaataaaact
ttagacaaatacttatatgatatagattatgtccttgattcgtttaattatgttgtatta
aaccctaatgctataaaatattatagtaatggtggctcaatagatgataaaaggttttta
aaaaataatttcgataaagatgatgaatttgtaagagtatacagtacagataatttctta
ggattaggaaaattatcaaaacacaataatacaataagtgttaaaagtgataagatgttc
atataa

DBGET integrated database retrieval system