KEGG   Pseudomonas frederiksbergensis: PFAS1_28610
Entry
PFAS1_28610       CDS       T04786                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00624  Polycyclic aromatic hydrocarbon degradation
pfk00626  Naphthalene degradation
pfk00627  Aminobenzoate degradation
pfk00633  Nitrotoluene degradation
pfk00642  Ethylbenzene degradation
pfk01100  Metabolic pathways
pfk01120  Microbial metabolism in diverse environments
pfk01220  Degradation of aromatic compounds
Module
pfk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PFAS1_28610
   00633 Nitrotoluene degradation
    PFAS1_28610
   00642 Ethylbenzene degradation
    PFAS1_28610
   00626 Naphthalene degradation
    PFAS1_28610
   00624 Polycyclic aromatic hydrocarbon degradation
    PFAS1_28610
Enzymes [BR:pfk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     PFAS1_28610
    1.14.12.23  nitroarene dioxygenase
     PFAS1_28610
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     PFAS1_28610
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: APV43288
UniProt: A0A1P8F4B9
Position
unnamed:4456..5805
AA seq 449 aa
MNYNNKILVSESGLSQKHLIHGDEELFQHELKTIFARNWLFLTHDSLIPAPGDYVTAKMG
IDEVIVSRQNDGSIRAFLNVCRHRGKTLVSVEAGNAKGFVCSYHGWGFGSNGELQSVPFE
KDLYGESLNKKCLGLKEVARVESFHGFIYGCFDQEAPPLMDYLGDAAWYLEPMFKHSGGL
ELVGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGESIFSSLAGNAALPPEGAGL
QMTSKYGSGIGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGDVRARIYRSHLNCTV
FPNNSMLTCSGVFKVWNPIDANTTEVWTYAIVEKDMPEDLKRRLADSVQRTFGPAGFWES
DDNDNMETASQNGKKYQSRDSDLLSNLGFGKDVYGDAVYPGVVGKSAIGETSYRGFYRAY
QAHVSSSNWAEFEHASSTWHTELTKTTDR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaattacaataataaaatcttggtaagtgaatctggtctgagccaaaagcacctgatt
catggcgatgaagaacttttccaacatgaactgaaaaccatttttgcgcggaactggctt
tttctcactcatgatagcctgattcctgcccccggcgactatgttaccgcaaaaatgggg
attgacgaggtcatcgtctcccggcagaacgacggttcgattcgtgcttttctgaacgtt
tgccggcatcgtggcaagacgctggtgagcgtggaagccggcaatgccaaaggttttgtt
tgcagctatcacggctggggcttcggctccaacggtgaactgcagagcgttccatttgaa
aaagatctgtacggcgagtcgctcaataaaaaatgtctggggttgaaagaagtcgctcgc
gtggagagcttccatggcttcatctacggttgcttcgaccaggaggcccctcctcttatg
gactatctgggtgacgctgcttggtacctggaacctatgttcaagcattccggcggttta
gaactggtcggtcctccaggcaaggttgtgatcaaggccaactggaaggcacccgcggaa
aactttgtgggagatgcataccacgtgggttggacgcacgcgtcttcgcttcgctcgggg
gagtctatcttctcgtcgctcgctggcaatgcggcgctaccacctgaaggcgcaggcttg
caaatgacctccaaatacggcagcggcattggtgtgttgtgggacggatattcaggtgtg
catagcgcagacttggttccggaattgatggcattcggaggcgcaaagcaggaaaggctg
aacaaagaaattggcgatgttcgcgctcggatttatcgcagccacctcaactgcaccgtt
ttcccgaacaacagcatgctgacctgctcgggtgttttcaaagtatggaacccgatcgac
gcaaacaccaccgaggtctggacctacgccattgtcgaaaaagacatgcctgaggatctc
aagcgccgcttggccgactctgttcagcgaacgttcgggcctgctggcttctgggaaagc
gacgacaatgacaatatggaaacagcttcgcaaaacggcaagaaatatcaatcaagagat
agtgatctgctttcaaaccttggtttcggtaaggacgtatacggcgacgcggtctatcca
ggcgtcgtcggcaaatcggcgatcggcgagaccagttatcgtggtttctaccgggcttac
caggcacacgtcagcagctccaactgggctgagttcgagcatgcctctagtacttggcat
actgaacttacgaagactactgatcgctaa

DBGET integrated database retrieval system