KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM537990
Entry
Phum_PHUM537990   CDS       T01223                                 
Name
(RefSeq) vacuolar sorting protein 4A, putative
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03250  Viral life cycle - HIV-1
phu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    Phum_PHUM537990
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Phum_PHUM537990
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM537990
   03400 DNA repair and recombination proteins [BR:phu03400]
    Phum_PHUM537990
Membrane trafficking [BR:phu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    Phum_PHUM537990
DNA repair and recombination proteins [BR:phu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    Phum_PHUM537990
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 AAA_16 AAA_22 AAA_5 IstB_IS21 RuvB_N AAA_14 AAA_18 AAA_2 DUF815 AAA_33 AAA_24 RNA_helicase Cwf_Cwc_15 TniB NACHT AAA_17 Mg_chelatase PhoH AAA_7 DUF5906 bpMoxR Sigma54_activat Sigma54_activ_2 AAA_28 YhdB
Other DBs
NCBI-GeneID: 8235442
NCBI-ProteinID: XP_002431625
VectorBase: PHUM537990
UniProt: E0VZT1
AA seq 439 aa
MSGTTTLQKAIDLVTRATEEDKNKNYEEALRLYEHGVEYFLHAIKYEAQGERAKESIRAK
CLQYLDRAEKLKEYLKKGKNIKKPVKDGEASKDDKKSDSDSDDDDPEKKKLLAKLEGAIV
VEKPSVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRIPWKGILLFGPPGTGKSYLAK
AVATEANNSTFFSVSSSDLVSKWLGESEKLVKNLFELARQHKPSIIFIDEIDSLCSSRSD
NESESARRIKTEFLVQMQGVGNDMDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPEEPA
RLTMFKLHLGSTRHTLTDEDLRQLAAQTEGYSGADISIVVRDALMQPVRKVQTATHFVRV
RGPSPTDPSVIVDDLLTPCSPGHKGAIEMNWMDVPGDKLYEPPVTMADMLRSVATSKPTV
NAEDLKKLDQFTQDFGQEG
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtctggtacaacaacgttacaaaaagcaattgatcttgttacgagagccacggaagaa
gataaaaataaaaattatgaggaagcattaagattatacgagcacggtgtagaatatttt
ttacacgccattaaatatgaagctcagggggaacgagcgaaagaaagtataagagccaag
tgcctgcaataccttgatagagctgaaaaattgaaagaatacctcaaaaaagggaaaaat
attaaaaaaccagttaaagatggtgaagcatctaaagatgacaaaaaaagtgatagtgat
agtgatgatgatgatcctgagaaaaaaaaattattagccaaacttgaaggtgctatagtt
gttgaaaaaccctctgtcaaatggtcggatgtagcgggattagagggagctaaagaggca
ctcaaagaagctgtaattctcccaattaaatttcctcatttattcactgggaaaagaatt
ccatggaaaggaattttgcttttcgggcccccaggaacgggtaaatcatatttggcgaaa
gcagtcgctactgaagctaataattcgacatttttctccgtatcttcatctgatttggtg
tctaaatggcttggagaatctgaaaaacttgtgaaaaatttgtttgaattagccagacag
cataaaccgagtataatatttatagatgaaattgattctctctgctcttcgagaagcgat
aatgaaagtgaatcagctcgaagaatcaaaactgaatttttagttcagatgcaaggagtt
ggaaacgacatggatggaattttagtattaggagcgactaatattccctgggttttggat
tctgccattcgaagaagatttgaaaaaagaatttacattcctctacccgaagaaccggcc
agattgacaatgtttaaattgcatttaggatctactcgtcacactctaaccgatgaagat
ctcagacagttggctgcccaaaccgaagggtactctggtgctgatatcagtatcgttgta
cgagatgcattgatgcaacctgttagaaaagtccaaacggctacacattttgtcagagtc
agaggaccgtcgcccacagatccttctgttatagtcgacgaccttttgactccatgttca
cctggtcataaaggagccatagaaatgaattggatggacgtaccaggtgataaactttac
gagccgcccgttacaatggcggatatgttaaggtcggtcgccacgtccaaaccgacagtt
aatgcggaagatttgaaaaaattagatcagttcactcaggatttcggacaggaaggataa

DBGET integrated database retrieval system