KEGG   Scheffersomyces stipitis: PICST_33873
Entry
PICST_33873       CDS       T01023                                 
Symbol
MSP1
Name
(RefSeq) 40 kDa putative membrane-spanning ATPase
  KO
K22530  outer mitochondrial transmembrane helix translocase
Organism
pic  Scheffersomyces stipitis
Brite
KEGG Orthology (KO) [BR:pic00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pic02000]
    PICST_33873 (MSP1)
Transporters [BR:pic02000]
 Other transporters
  Pores ion channels [TC:1]
   PICST_33873 (MSP1)
SSDB
Motif
Pfam: AAA AAA_lid_3 RuvB_N AAA_14 AAA_16 AAA_2 AAA_5 AAA_22 IstB_IS21 Parvo_NS1 RNA_helicase TniB AAA_24 Mg_chelatase AAA_7 AAA_33 nSTAND3 AAA_18 TIP49 Sigma54_activ_2 NACHT AAA_28 AAA_17 ATPase_2 NB-ARC Zeta_toxin DUF815 AAA_25 Rad17 Bac_DnaA Sigma54_activat TsaE ABC_tran Viral_helicase1
Other DBs
NCBI-GeneID: 4841135
NCBI-ProteinID: XP_001386533
JGI: 33873
UniProt: A3M0D7
Position
8:670230..671303
AA seq 357 aa
MAKFKLDIKFLGDLFILAGAGLSVYFILNNILNDYVDNSMKNKESEKKGKGILKKLQSSN
PHLRNISLNQYEKSLLNSLVTPEEISVTFNDVGGLQDIIDELREAVILPLTEPELFATHS
DLIQSPKGVLFYGPPGCGKTMLAKAIAKESGAFFLSIRMSTIMDKWYGESNKITDAIFSL
ANKLQPCIIFIDEIDSFLRDRSSSDHEVSAMLKAEFMTLWDGLKSNGRIMVMGATNRKSD
IDEAFLRRLPKTFAIGKPNESQRRSILSKILSGAKLDEKDFDLEYIVANTKGFSGSDLRE
LCREAAILPVREYIRENYNYRSGKLSKDENEDMPVRPLKTSDFVKTAESTIQPATID
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggctaagttcaaactcgatataaagtttcttggagacttgtttattcttgcgggagct
gggctctcagtatatttcatactcaacaatatactcaacgactatgtagacaactctatg
aagaacaaggaatcggagaaaaagggcaagggcattctcaagaaattacagagttctaat
ccgcacctccgcaacatctccctcaaccagtacgagaagctgttgctcaattcgttggtt
acaccagaagaaatatcagtaactttcaatgatgtgggcggtttgcaagacataattgac
gagttgagggaagcggtgattcttcctttaacagaaccagagcttttcgctacccatctg
gatttgatccagtcacctaagggtgtcttattctacggtccccctggatgtggtaagaca
atgttggccaaagctattgccaaagaaagtggtgcgtttttcttgctgataaggatgtcg
actattatggacaaatggtacggtgagtcgaacaagatcaccgatgccatcttctcactt
gctaacaaattgcaaccctgtattattttcattgacgaaatagattcgtttttgagagac
aggtcttccagcgaccacgaagtcagtgccatgttaaaggctgaattcatgacgttgtgg
gacggcttgaagtctaacggaagaatcatggtaatgggcgctaccaatcgtaagagtgac
attgacgaagccttcttgagaagattacccaaaacttttgctattggcaaaccaaacgaa
tcgcaaagacgttccatattgtctaaaatactaagtggagccaagctcgatgaaaaagat
tttgacttggaatacatcgttgctaatacaaaaggctttagtggttctgacttgagagaa
ttatgtcgtgaagctgccattcttcccgtcagggagtacatcagagagaattacaactat
aggagtgggaagttgagcaaggatgaaaatgaagacatgcctgttagaccgttgaagact
tctgattttgtaaagactgccgagtccaccattcaacctgctaccattgattag

DBGET integrated database retrieval system