KEGG   Polaromonas naphthalenivorans: Pnap_2485
Entry
Pnap_2485         CDS       T00459                                 

Definition
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00624  Polycyclic aromatic hydrocarbon degradation
pna00626  Naphthalene degradation
pna00627  Aminobenzoate degradation
pna00633  Nitrotoluene degradation
pna00642  Ethylbenzene degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Module
pna_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Pnap_2485
   00633 Nitrotoluene degradation
    Pnap_2485
   00642 Ethylbenzene degradation
    Pnap_2485
   00626 Naphthalene degradation
    Pnap_2485
   00624 Polycyclic aromatic hydrocarbon degradation
    Pnap_2485
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     Pnap_2485
    1.14.12.23  nitroarene dioxygenase
     Pnap_2485
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     Pnap_2485
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABM37789
UniProt: Q3S4D0
Position
complement(2622768..2624111)
AA seq 447 aa
MIYENLVSKAGLTQKHLIHGDKELFQHEMKTIFARNWLFLTHDSLIPSPGDYVTAKMGVD
EVIVSRQNDGSVRAFLNVCRHRGKTLVNAEAGNAKGFVCSYHGWGFGSNGELQSVPFEKE
LYGDAIKKKCLGLKEVPRVESFHGFIYGCFDAEAPPLMDYLGDAAWYLEPIFKHSGGLEL
VGPPGKVVIKANWKAPSENFVGDAYHVGWTHASSLRSGQSIFTPLAGNAMLPPEGAGLQM
TSKYGSGMGVLWDAYSGVHSADLVPDMMAFGGAKQEKLAKEIGDVRARIYRSHLNCTVFP
NNSILTCSGVFKVWNPIDENTTEVWTYAIVEKDMPEELKIRLADAVQRTFGPAGFWESDD
NDNMETESQNAKKYQSSNSDLLANLGFGKDVYGDEVYPGVVGKSSIGETSYRGFYRAYQA
HISSSNWAEFENSSRSWHAELTQTADR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgatttatgaaaacttagtgagtaaagcagggctgacgcaaaagcacctgattcatggt
gacaaagaacttttccagcatgagatgaagaccatcttcgcgcggaactggctttttttg
acccatgacagtctgattccctcccccggcgactatgtcacagcaaaaatgggcgtcgat
gaagtcatcgtctcccgtcagaacgatggctccgtgcgagcctttttgaatgtttgccgc
caccggggcaagacactggtgaacgcagaagccggaaatgcgaaaggctttgtgtgcagt
taccacggctggggtttcggctccaacggtgaacttcaaagcgttccctttgaaaaagaa
ttgtacggagatgcgatcaaaaagaagtgcttgggcttgaaagaagtcccgcgcgtcgag
agctttcatggctttatttacggctgttttgatgcagaggctcccccgctcatggattat
ctgggtgatgcagcctggtacctggagcccatcttcaagcactcaggcggtctggaactt
gtaggccccccgggcaaagtggtgatcaaggccaactggaaggcgccctcggaaaacttt
gtgggtgacgcataccacgtgggctggacgcacgcatcgtctttgcgctcaggtcagtcg
atatttacccctctcgcgggcaacgccatgctgccgcccgaaggcgcgggcttgcaaatg
accagcaaatacggcagcggcatgggggtgttgtgggacgcttattccggcgttcacagc
gccgacctggtgccggacatgatggcattcggcggcgcaaaacaggaaaagctcgccaaa
gaaatcggtgatgttcgggcgcggatttaccgcagccatctgaactgcacggttttcccg
aacaacagcattttgacctgctccggcgttttcaaggtctggaacccgatcgacgagaac
acgaccgaagtttggacgtatgcgatcgtggaaaaagacatgccggaggaattgaaaatc
cgcttagccgacgcggttcagcgcacgttcggacctgcaggcttctgggaaagcgacgac
aacgacaacatggaaaccgagtcgcaaaatgccaagaaataccaatccagcaacagcgat
ctgcttgccaacctgggtttcggcaaggacgtctacggtgatgaagtatatcccggcgtc
gttggcaagtcgtccatcggtgaaaccagctatcgcggcttctaccgcgcctaccaagcg
cacatcagcagctccaattgggccgagttcgaaaacagctcacgcagttggcatgccgaa
ctcacccagaccgccgatcgctaa

DBGET integrated database retrieval system