KEGG   Polaromonas naphthalenivorans: Pnap_4198
Entry
Pnap_4198         CDS       T00459                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pna00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Pnap_4198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pna02044]
    Pnap_4198
Enzymes [BR:pna01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Pnap_4198
Secretion system [BR:pna02044]
 Type IV secretion system
  Trb secretion system protein
   Pnap_4198
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG HerA_C AAA_10 AAA_22 TraG-D_C CbiA AAA_16 DUF87 FtsK_SpoIIIE NACHT ABC_tran RsgA_GTPase AAA_7 CCDC53
Other DBs
NCBI-ProteinID: ABM39481
UniProt: A1VV03
Position
pPNAP01:73846..76287
AA seq 813 aa
MMNLAEYRKRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
QLNNALRRLGSGWALFVEAERRAAADYPYSDFPEPLSWLVDEERRASFEEDHSHFESGYH
LTLAYLPAEESRVRAAKLLYENTPQRGVDWRERLESFISETDRFFDLLDGVMPEIVWLDD
SQTLTYLHATVSARRYRVAVPEHPFYLDALLADSALVGGLAPMLGDQHLRVASVRGFPTS
TWPGLLDDLNRLGFAYRWSTRFLCMDKADAETELGRLRRQWFAKRKNVVALLRETIFQQE
SPLVDTDASNKANDADAALQELGSDQVAFGYVTATVTVLDPDSSVADEKLRRIERVIQGR
GFVTIPETLNAVEAWLSSIPGNAYANVRQPIISTLNLAHLMPVSAVWAGPERNNHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVVGPTGMGKSVLLATLAMQFRRYPGSRIFAFDMGR
SMRATTLGLGGEHYDLGKGWEEGGEIAFQPLARIDQDGYRTWAAEWLEGRLLHEGAAVGP
EEKAMVWSALGSLAGAPVEQRTLTGLSVLLQSNALRQALQPYVLGGAHGKLLDADSDRLG
SGSVQCFEMEELMHSKAAVLAVLGYLFARFDERFDGAPTLLILDEAWLFLDDPVFAARIR
QWLKTLRKKNVSVIFATQSLADIQNSSIAPAIVESCASRIFLPNPQATEPQIRTIYEGFG
LNRRQIDIVAEAVPKRDYYYQSRLGNRLFDLDLGPVTLAFAGASTPQDQRDIDAVSRSES
SSDFAAAWLRHRGLDWAADLVPSFPSIPQENAP
NT seq 2442 nt   +upstreamnt  +downstreamnt
atgatgaatctcgctgaataccgcaaacgtcccgcactgctggccgattggttgccctgg
gccgggctggttgcgccgggcgttgtgctcaacaaggatggctcgttccagcgcacggcg
cgctttcgcgggccggacctggacagcgccacgcagggcgaactgatcgccacgtccgcg
cagctgaacaatgcgctgcgccggttggggtcaggctgggccttgttcgtggaggccgaa
cggcgcgccgctgccgactacccgtactcggattttccggagccgctgtcctggctggtg
gacgaagaacggcgggcttcgttcgaggaagaccacagccacttcgagagcggctaccac
ctgacgctggcgtacctgcccgctgaggaatctcgcgtccgcgcggccaagctgctgtac
gagaacacgccacagcgcggcgtggactggcgcgagcggctggagtcgttcatctctgag
acggatcgttttttcgacttgctcgatggggtcatgccggagatcgtctggctggacgac
agccagaccttgacctacctgcatgcgacggtttcggcgcggcgctaccgggtggcggtg
ccggaacatccgttctacctcgatgccttgctggccgattccgcgctggtcggaggtttg
gccccgatgctgggtgaccagcacctacgggtggcgtcggtgcgcggtttccccacctcg
acctggccgggtctcctggacgacttgaaccgcctgggcttcgcctaccgctggtccaca
cgctttctctgcatggacaaggccgacgcggaaacggagttgggccgactgcgccgccag
tggttcgccaagcgcaaaaacgtggtggccttgctgcgcgaaaccatcttccagcaggaa
agcccgctggtcgataccgatgcctcgaacaaggccaacgatgccgatgccgctttgcag
gaactgggcagcgatcaagtcgccttcggctatgttactgccacggtgacggtgctcgat
ccagattcttcggtggccgatgaaaaactgcgtcggattgaacgtgtcatccaaggccgc
ggtttcgtcacgatcccggaaacgctcaatgccgtggaggcgtggctgtcctcgattccg
ggtaatgcctacgccaacgtgcgacagcccatcatctcgacgctaaatctggcgcacctg
atgccagtgtcggccgtatgggccgggccggagcgcaataaccatttggacgggccgccg
ctgatcgtgacgcgcaccgatggcgccacgccgttccggctggtgacgcacatcggcgac
gtgggccacacgctggtggtcgggccgactggtatgggcaagtcggtgctgctggctacc
ttggcgatgcagttccgccgctatcccggttcgcgcatctttgccttcgacatgggtcgc
tcgatgcgcgccaccaccctgggactgggcggcgaacattacgacctgggcaaaggatgg
gaggaaggtggcgaaatcgccttccagccgctggcccgcatcgaccaggacggctaccgc
acctgggccgccgaatggctggaaggccgcttactgcatgaaggcgcagccgtcggcccg
gaagaaaaggccatggtctggtcggcgctgggaagtctggcgggcgcaccggtggagcag
cgcaccctgaccgggctgtcggtactgctgcaatcgaatgccttgcgccaggccttgcag
ccttacgtgctgggcggcgcgcacggcaagctgctggatgcggattcggatcgcttgggt
tctggttccgtccagtgcttcgagatggaagagctgatgcatagcaaggccgccgtgctg
gccgtgctgggctatctgttcgcccgcttcgatgagcggttcgacggcgcgccgaccttg
ctcattctggacgaggcctggctgtttctggatgacccggtgtttgccgcgcgcatccgc
cagtggctcaagacgctgcgcaaaaagaacgtcagtgtgatcttcgctacgcaatcgctg
gccgacatccagaactcgtccatcgccccggccatcgtggagagctgcgccagccgcatc
ttcctgccgaatccgcaggcgaccgaaccacagattcgcacgatctacgaaggctttggt
ttgaaccgtcgccagatcgacatcgtggccgaggcggttcccaaacgcgactactactac
cagtcccggctgggcaatcgcttgtttgacctggacctggggccggtcacgctggccttt
gccggtgcttcgacaccgcaggaccaacgcgacattgatgcggtatcccgctcggagtcg
tcttccgacttcgcagccgcctggctgcgccatcgcggccttgactgggccgccgacctt
gttccgtcctttccatccattccacaggagaacgcaccatga

DBGET integrated database retrieval system