KEGG   Paralichthys olivaceus (Japanese flounder): 109634633
Entry
109634633         CDS       T06037                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
pov  Paralichthys olivaceus (Japanese flounder)
Pathway
pov04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pov00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109634633 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pov03000]
    109634633 (mecom)
Transcription factors [BR:pov03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    109634633 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-met zf-BED PyrI_C
Other DBs
NCBI-GeneID: 109634633
NCBI-ProteinID: XP_019950854
Position
Unknown
AA seq 1071 aa
MKAEEYSCDTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKQPCGMPPSSFLNPGGDSDL
KAQEPQDLRPLHLSHGLHECKECDQVFPDAQSLEGHILSHSEEREYKCDQCPKAFNWKSN
LIRHQMSHDNGKHYECENCSKVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLKQ
HKHIHSSVKPFMCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRR
FCEGKNHFTAGGLFAQGMSLPGAPGLDKSALAMGHGSAGLADYFGASRHHGGLTFPAAPA
FPFSFPGLFPSGLYHRPQLIPATTSPVRQPTHAPLVGPGAELSKSPLLPQSPGCQESREL
LKALRKDGGSPGSQMTASELHTQSSSSTKQRIKQSDQSESSDLDDVSTPSGSDLESTSGS
ELESDMDSERERGAARENGKGPKRKASEGGPQSPSLTGSSAAKDFAGPSLIPSSLDEHTA
VTGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGSLPYPSMFPLPFFPAFSPPVYPFPDR
DLRPPGLKGEPQSPADDGRKAQSKSSSESPFDLTTKRKEEKSAPFAPSKPETSHSSGQDQ
PLDLSLGSRGRGRNPREEEAKKNLGYEEEKGAVEIPKADTSLQHARPTPFFMDPIYSRVE
KRRMSDPFETLKDKYMRPAPGFLFHPQFRLPDQRTWMSAIENMAEKLETFGSLKPESGDL
LRSVPSMFDFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCK
YCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAMSS
PQSELDSGSAILDDKEDSYFNEIRNFISNTGQNQTSPDPSEEGLNGGPFEEEKPLMASHG
SRDLEDEEAEELGADEEEGEEPSNASGKPEGEVLPSNLSDDVMQEEMDFTGPNDLNLNCK
TSPRGYEDEEEQSSYSALDHIRHFSDMRKLEESEVSDGDGDEDDGSFGSPSLTEAVKQPL
FRKSKSQAYAMMLSLAEKDSLHPATHTPATMWHSLARAAAESSAIQSLSHV
NT seq 3216 nt   +upstreamnt  +downstreamnt
atgaaggccgaagagtattcatgtgacaccatggctcctgatattcatgaggagaggcag
taccgctgtgaggactgtgaccagcactttgagtcccgcaaccagctgctggaccaccag
aagcagccatgtgggatgcccccctcctccttccttaacccaggaggggacagtgacctt
aaggcacaggaacctcaagacttgcgaccgctccacctgtcccacggtctacatgagtgt
aaggagtgtgaccaggtcttccctgatgctcagagcctggagggccacattctgtcccac
tctgaggagagggagtataagtgtgaccagtgccccaaagccttcaactggaaatcaaac
ctgatccgacatcagatgtcacatgacaatggcaagcactacgaatgtgaaaactgctca
aaggtgttcacagaccccagtaacctgcagaggcacatccgctcacaacacgtcggggca
cgggcccacgcctgctccgactgtggcaagacgttcgctacgtcttctggcctcaagcag
cataagcacatccacagcagtgtcaagcccttcatgtgtgaggtatgccacaagtcctac
acccagttctctaacctgtgccgccacaaacgcatgcatgctgactgtcgcacacagatc
aagtgcaaggactgtgggcagatgttcagcaccacatcctccctcaacaagcaccggcgc
ttctgtgaaggaaagaaccatttcactgcagggggattgtttgcccagggtatgtcactc
cctggagccccaggcttggacaaatcagctctggcgatgggccacggcagtgctggattg
gcagattactttggggccagtcgtcaccatggaggtcttaccttccctgctgccccagca
tttccttttagcttccctggtctcttcccctctggactctaccacaggccacagctcatt
cctgccaccacctctcctgtcaggcaaccaacacatgcacctcttgtcgggcctggtgca
gagctaagtaagagtccactgctgcctcagagccctggctgtcaggagtcccgcgagctc
ctcaaagctctccgtaaagatggtggctcacctggcagtcagatgacagcctcagagctc
catactcagagctcatcctccacaaagcagcgaatcaaacagagtgaccagtccgagagc
agtgacctggacgatgtcagcacgcccagcggaagtgatttggagagcacatcaggctcc
gagctggagagtgacatggacagtgagagggagaggggtgctgctcgagaaaatggaaaa
ggccccaagaggaaggccagtgagggaggcccccagagccccagcctgacaggcagcagc
gctgccaaagactttgcaggcccttccctcatcccatcctcgctggacgagcacacagct
gtaactggggctgtgaatgactctattaaggccattgcctcaattgctgagaagtacttt
ggctccacaggactggctggcctgcaggacaagaaggttgggtctctgccctacccctcc
atgttccctctgcctttcttcccagctttctctcctccagtttaccctttcccagacagg
gacctcagacctccgggcctaaagggcgagccccagtctccggcagatgatggcaggaag
gcccagagcaaatcttcatccgaatcgccatttgaccttactaccaagagaaaggaggaa
aaatcagctccattcgctccctccaaaccagagacctcccactctagtggtcaggatcag
ccgctggacctgagtctggggagcaggggccgtggacggaatccaagagaggaggaggca
aagaagaacctgggttatgaagaagagaagggagcggtggagatcccaaaggcagacacc
tccttacagcatgccaggcccaccccatttttcatggaccccatctacagcagggttgag
aagaggagaatgagcgatccgtttgagactctgaaagacaagtacatgcggccagcacca
ggtttcctcttccatccacagtttcgtttgccagatcagagaacttggatgtctgcgatc
gagaacatggcggagaagctggagacgtttggctcgttgaagccggagtctggtgacctc
ctgcgctccgtcccctccatgtttgatttcagagccccgccctctgcacttccagaaacg
ctgctgcgcaagggcaaggagcgctacacgtgcagatattgtgggaaaatattcccccgc
tctgccaacctgacccgccacctcaggactcacacaggagagcaaccatataggtgtaaa
tactgtgaccgctccttcagcatctcctcaaacctgcaacgtcacatccgcaacatccac
aacaaggagaagcccttcaagtgccacctgtgtgaccgctgcttcggccagcagaccaac
ctggaccgtcacctcaaaaagcacgagaacggcaacttgtcaggcactgcaatgtcgtct
cctcagtctgaactggacagtggcagcgccatactggacgacaaagaagactcgtatttc
aacgaaataagaaattttatcagcaacactgggcagaaccagacatccccggacccctca
gaggaagggttaaatggcggcccatttgaagaggagaagccactgatggccagccatggg
tcacgtgacctggaagacgaggaagcagaggagctcggtgctgatgaagaagaaggagaa
gagcctagcaacgcctctgggaaaccggaaggggaggtgctcccgagcaacctcagcgat
gacgtcatgcaagaggaaatggacttcactgggcccaacgacttgaacctcaactgcaaa
acctctcccagggggtatgaggatgaggaggagcagagcagctactcagccctggatcat
attcgccacttttcagacatgcgaaagctggaggagagtgaagtgagcgatggtgacgga
gatgaggacgatggatcattcggctccccttctctgaccgaggcagtcaaacagccactc
tttagaaaatctaagtctcaggcgtatgccatgatgctgtctctggctgaaaaggactct
ctccacccagccacccacacccccgccaccatgtggcacagtctggcacgggccgctgca
gagtccagcgccatccagtccctcagccacgtatga

DBGET integrated database retrieval system