KEGG   Pseudomonas putida F1: Pput_2934
Entry
Pput_2934         CDS       T00537                                 
Name
(GenBank) hypothetical protein
Organism
ppf  Pseudomonas putida F1
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 AAA_22
Other DBs
NCBI-ProteinID: ABQ79062
UniProt: A5W4K2
Position
3317579..3319705
AA seq 708 aa
MGEHAMESLLRPAVELYTVGICAGAGALCLHSPWAVALSPEVGAGMALAYTAFGLKRLNE
ARIVLRYRRNIRRLPRYSLTSRQIPVSGKRLFMGRGFRWTRLHTQRLLEAQDPALARYVN
QSAAHQWARRMEHLLEKAPPGLSLLPRLTAWDSPFNPVRPLPPVGGSPLLHGVEPKEQEA
SLPLGERVGHTLVLGTTRVGKTRLAEVYITQDIHRPSQEVVIVFDPKGDADLLKRMYVEA
RRAGREHEFYVFHLGWPEISARYNAIGRFGRISEVASRIAGQLSGEGNSAAFREFAWRFV
NIIARALIELGRRPDYLQIQRHVVNIDALFIEYAQHFFARHDPQAWEAIVQIEGRLNEKN
IPRHMVGREKRVVAIEQYLSAKRIFDPVMDGLRSAVRYDRTYFDKIVASLLPLLEKLTSG
KTAQLLAPNYTDLDDPRPIFDWLQVIRKRGIVYVGLDALCDAEVAAAVGNSMFADLVSVA
GHIYKHGIDHGLPGSSSAADKVPINLHADEFNELMGDEFIPLINKGGGAGIQVTAYTQTL
SDIEARIGNRAKAGQVIGNFNTLQMLRVRETATAELLTNQLPKVNVQTRTLVSGATDTAD
PDARTDFTSSSQDRVTTTSVPLIEPAHIIALPKGQMFSFQEGGQLWKVRMPLPKPASDDA
MPADLQTLAERMRDSYNANAGSWWSTTGGAPTVDFDPEQPPPGRRHTP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgggcgaacatgcgatggagtccctgctgcgccctgcggtggagctgtacaccgtgggc
atctgcgccggtgccggcgccctgtgtctgcactcaccttgggcggtggcgctatcgcca
gaggtgggggcaggcatggccctggcctataccgcattcggcctgaagcggctcaacgag
gcacggatcgtcctgcgctatcggcgcaatatccgccgcctgccgcgctactcgctgacc
agccgacagattccggtgagcggcaagcgcctgttcatgggccgtggctttcgctggacc
cgcctgcacacccagcgtctgctcgaggcgcaggacccggcgttggcccgctacgtcaat
cagtcggccgcccaccagtgggcgcgacggatggaacatctgctggagaaggccccgcca
gggttgtcgctgttgccccgcctgaccgcctgggacagcccatttaacccggtacggccc
ctgccgccggtgggcggctcgccactgctgcacggcgtcgaaccaaaggaacaggaagcc
agcttgccgctgggcgagcgcgtcggccacaccctggtgctgggcaccacgcgagtcggc
aagacacgcttggccgaggtgtacatcacccaggacatacaccgacccagccaggaagtg
gtgatcgtcttcgaccccaagggcgatgccgacctgctcaagcgtatgtacgtggaagcg
cggcgcgccggccgtgagcatgaattctatgtgttccacctgggctggccggagatctcc
gcgcgctacaacgccatcggccgcttcggccgcatctccgaagtcgcctcccgcatcgct
ggccaactgagcggcgaaggcaattcggccgcatttcgcgagttcgcttggcgctttgtc
aacatcatcgcccgggccctgatcgagctcggccggcgccccgactacctgcaaatccag
cggcatgtggtgaacatcgatgcgctgttcatcgagtacgcccagcacttcttcgcccgc
catgatcctcaggcctgggaagcgatcgtgcaaatcgaaggccggctgaacgagaagaac
atcccgcgccacatggttggccgggaaaagcgcgtggtcgccatcgagcagtacctgagc
gccaagcgcatcttcgatccggtgatggacggccttcgctcagccgtacgctacgaccgt
acctacttcgacaagatcgtggcttcactgctgccactcctggaaaaactcaccagcggc
aagaccgcacaactgctcgcccccaactacaccgacctcgacgatccacggccgatcttc
gactggctgcaggtcatccgcaaacgcggcatcgtctacgtcggcctggatgcgctgtgc
gatgctgaggtcgccgccgctgtcggtaactcgatgtttgccgacctggtctccgtcgct
ggccatatctacaaacacggtatcgatcatggcctgccaggctcctccagcgccgcggac
aaggtgccgatcaacctgcacgccgacgagttcaacgaactgatgggcgacgagttcatt
ccactgatcaacaagggtggtggcgccggtatccaggtcaccgcctacacccagaccttg
agcgacattgaagcgcgtatcggcaaccgggccaaggccggccaggtcatcggcaacttc
aacaccctgcagatgctacgggtacgggagaccgccaccgccgaactgctgaccaaccaa
ctgcccaaggtcaacgtacagacccgcaccctggtctctggcgcgacggacaccgccgat
ccggatgcccgaaccgacttcacctcctcctcgcaggatcgggttaccaccacttcggta
ccgctgatcgagccggcgcacattatcgccttgcccaagggacagatgttctcgttccag
gaaggcggacaattgtggaaggtgcgcatgccgctaccgaagccggccagcgacgacgca
atgccggcagacctgcagaccctagcagagcgcatgcgcgattcctacaacgccaatgcg
gggagttggtggagcaccaccggcggcgctccgacggtcgatttcgatccagagcagcct
ccacccgggcgcagacacacaccgtaa

DBGET integrated database retrieval system