KEGG   Pan paniscus (bonobo): 100971238
Entry
100971238         CDS       T02283                                 

Definition
(RefSeq) cytochrome P450 11B2, mitochondrial
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00140  Steroid hormone biosynthesis
pps01100  Metabolic pathways
pps04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100971238
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100971238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pps00199]
    100971238
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     100971238
    1.14.15.5  corticosterone 18-monooxygenase
     100971238
Cytochrome P450 [BR:pps00199]
 Cytochrome P450, animal type
  CYP11 family
   100971238
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100971238
NCBI-ProteinID: XP_003819564
Position
8
AA seq 448 aa
MALRAKAEVCVAAPWLSLQRARALGTRAPRAPRTVLPFEAMPQHPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPRRMILEPWVAYR
QHRGHKCGVFLFEGEHPAQRTAIPWGRVCPVERLGLVGHSPSSASLNFLHALEVMFKSTV
QLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQHYTSIVAELLL
NAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHP
QKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAT
LFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVET
LTQEDIKMVYSFILRPGTSPLLTFRAIN
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcgtggcagcgccctggctgtccctgcaaagg
gcacgggcactgggcactagagcccctcgggcccctaggacggtgctgccgtttgaagcc
atgccccagcatccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgagcacctgcacctggagatgcaccagaccttccaggagctggggcccattttcagg
tacaacttgggaggaccacgcatggtgtgtgtgatgctgccggaggatgtggagaagctg
caacaggtggacagcctgcatccccgcaggatgatcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgtttgagggtgagcatccggcccagagg
acggccatcccgtggggtcgcgtctgccctgtggagcggctgggcctggttggccacagc
cccagttctgccagcctgaacttcctccatgccctggaggtcatgttcaaatccaccgtc
cagctcatgttcatgcccaggagcctgtctcgctggatcagccccaaggtgtggaaggag
cactttgaggcctgggactgcatcttccagtacggcgacaactgtatccagaaaatctat
caggaactggccttcagccgccctcaacactacaccagcatcgtggcggagctcctgttg
aatgcggaactgtcgccagatgccatcaaggccaactctatggaactcactgcagggagc
gtggacacgacggtgtttcccttgctgatgacgctctttgagctggctcggaaccccaac
gtgcagcaggccctgcgccaggaaagcctggctgccgcagccagcatcagtgaacatccc
cagaaggcaaccaccgagctgcccttgctgcgggcggccctcaaggagaccttgaggctc
taccctgtgggtctgtttttggagcgagtggtgagctcagacttggtccttcagaactac
cacatcccagctgggacattggtgcaggttttcctctactcgctgggtcgcaacgccacc
ttgttcccgaggcctgagcggtataatccccagcgctggctagacatcaggggctccggc
aggaacttccaccacgtgccctttggctttggcatgcgccagtgcctcgggcggcgcctg
gcagaggcagagatgctgctgctgctgcaccacgtgctgaagcacttcctggtggagaca
ctaacccaagaggacataaagatggtctacagcttcatattgaggcctggcacgtccccc
ctcctcactttcagagcaatcaactag

DBGET integrated database retrieval system