KEGG   Pan paniscus (bonobo): 100974026
Entry
100974026         CDS       T02283                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04064  NF-kappa B signaling pathway
pps04140  Autophagy - animal
pps04152  AMPK signaling pathway
pps04310  Wnt signaling pathway
pps04380  Osteoclast differentiation
pps04520  Adherens junction
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04660  T cell receptor signaling pathway
pps04668  TNF signaling pathway
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05161  Hepatitis B
pps05162  Measles
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100974026 (MAP3K7)
   04310 Wnt signaling pathway
    100974026 (MAP3K7)
   04064 NF-kappa B signaling pathway
    100974026 (MAP3K7)
   04668 TNF signaling pathway
    100974026 (MAP3K7)
   04152 AMPK signaling pathway
    100974026 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100974026 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100974026 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100974026 (MAP3K7)
   04620 Toll-like receptor signaling pathway
    100974026 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    100974026 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    100974026 (MAP3K7)
   04660 T cell receptor signaling pathway
    100974026 (MAP3K7)
   04657 IL-17 signaling pathway
    100974026 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100974026 (MAP3K7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100974026 (MAP3K7)
   05161 Hepatitis B
    100974026 (MAP3K7)
   05171 Coronavirus disease - COVID-19
    100974026 (MAP3K7)
   05162 Measles
    100974026 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    100974026 (MAP3K7)
   05169 Epstein-Barr virus infection
    100974026 (MAP3K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100974026 (MAP3K7)
   05135 Yersinia infection
    100974026 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100974026 (MAP3K7)
   05140 Leishmaniasis
    100974026 (MAP3K7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100974026 (MAP3K7)
   05418 Fluid shear stress and atherosclerosis
    100974026 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100974026 (MAP3K7)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100974026 (MAP3K7)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: TKL group
  MLK family
   100974026 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 100974026
NCBI-ProteinID: XP_003822933
UniProt: A0A2R8ZZW1
Position
6
AA seq 606 aa
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtctacagcctctgccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttctcaggtcctcaactttgaagagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcgtttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccatttgatgagattggtggcccagctttccgaatcatg
tgggccgttcataatggtactcgaccaccactgatcaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacgagtaacaaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaagcgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgccc
ccaacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagctaggatcgct
gcaaccacagcctattccaagcctaaacggggccaccgtaaaaccgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtagatccatc
caagacttgactgtaactggaacagaacctggtcaggtgagcagtaggtcatccagtccc
agtgtcagaatgattactacctcaggaccaacctcagaaaagccaactcgaagtcatcca
tggacccctgatgattccacagataccaatggatcagataactccatcccaatggcttat
cttacactggatcaccaactacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgaacagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttactaccagcaatgcaaaaaacaactagaggtcatcagaagtcagcagcag
aaacgacaaggcacttcatga

DBGET integrated database retrieval system