KEGG   Pan paniscus (bonobo): 100980629
Entry
100980629         CDS       T02283                                 

Gene name
TEK
Definition
(RefSeq) TEK receptor tyrosine kinase
  KO
K05121  endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04066  HIF-1 signaling pathway
pps04151  PI3K-Akt signaling pathway
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100980629 (TEK)
   04014 Ras signaling pathway
    100980629 (TEK)
   04015 Rap1 signaling pathway
    100980629 (TEK)
   04066 HIF-1 signaling pathway
    100980629 (TEK)
   04151 PI3K-Akt signaling pathway
    100980629 (TEK)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100980629 (TEK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100980629 (TEK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100980629 (TEK)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100980629 (TEK)
Protein kinases [BR:pps01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   100980629 (TEK)
CD molecules [BR:pps04090]
 Proteins
  100980629 (TEK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_Tie2_1 fn3 Pur_ac_phosph_N APH EGF_2 fn3_2 hEGF DUF2369 Pkinase_fungal DUF4702
Other DBs
NCBI-GeneID: 100980629
NCBI-ProteinID: XP_003830746
UniProt: A0A2R9AYN0
Position
9
AA seq 1124 aa
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLSH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGEC
ICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKAYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSLQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3375 nt   +upstreamnt  +downstreamnt
atggactctttagccagcttagttctctgtggagtcagcttgctcctttctggaactgtg
gaaggtgccatggacttgatcttgatcaattccctacctcttgtatctgatgctgaaaca
tctctcacctgcattgcctctgggtggcgcccccatgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaggatccgctggaagttactcaagatgtgaccaga
gaatgggctaaaaaagttgtttggaagagagaaaaggctagtaagatcaatggtgcttat
ttctgtgaagggcgagttcgaggagaggcaatcaggatacgaaccatgaagatgcgtcaa
caagcttccttcctaccagctactttaactatgactgtggacaagggagataacgtgaac
atatctttcaaaaaggtattgattaaagaagaagatgcagtgatttacaaaaatggttcc
ttcatccattcagtgccccggcatgaagtacctgatattctagaagtacacctgtctcat
gctcagccccaggatgctggagtgtactcggccaggtatataggaggaaacctcttcacc
tcggccttcaccaggctgatagtccggagatgtgaagcccagaagtggggacctgaatgc
aaccatctctgtactgcttgtatgaacaatggtgtctgccatgaagatactggagaatgc
atttgccctcctgggtttatgggaaggacatgtgagaaggcttgtgaactgcacacattt
ggcagaacttgtaaagaaaggtgcagtggacaagagggatgcaaggcttatgtgttctgt
ctccctgacccctatgggtgttcctgtgccacaggctggaagggtctgcagtgcaatgaa
gcatgccaccctggtttttacgggccagattgtaagcttaggtgcagctgcaacaatggg
gagatgtgtgatcgcttccaaggatgtctctgctctccaggatggcaggggctccagtgt
gagagagaaggcataccgaggatgaccccaaagatagtggatttgccagatcatatagaa
gtaaacagtggtaaatttaatcccatttgcaaagcttctggctggccgctacctactaat
gaagaaatgaccctggtgaagccggatgggacagtgctccatccaaaagactttaaccat
acggatcatttctcagtagccatattcaccatccaccggatcctcccccctgactcagga
gtttgggtctgcagtgtgaacacagtggctgggatggtggaaaagcccttcaacatttct
gttaaagttcttccgaagcccctgaatgccccaaacgtgattgacactggacataacttt
gctgtcatcaacatcagctctgagccttactttggggatggaccaatcaaatccaagaag
cttctatacaaacccgttaatcactatgaggcttggcaacatattcaagtgacaaatgag
attgttacactcaactatttggaacctcggacagaatatgaactctgtgtgcaactggtc
cgtcgtggagagggtggggaagggcatcctggacctgtgagacgcttcacaacagcttct
atcggactccctcctccaagaggtctaaatctcctgcctaaaagtcagaccactctaaat
ttgacctggcaaccaatatttccaagctcggaagatgacttctatgttgaagtggagaga
aggtctctgcaaaaaagtgatcagcagaatattaaagttccaggcaacttgacttcggtg
ctacttaacaacttacatcccagggagcagtacgtggtccgagctagagtcaacaccaag
gcccagggggaatggagtgaagatctcactgcttggacccttagtgacattcttcctcct
caaccagaaaacatcaagatttccaacatcacacactcctcggctgtgatttcttggaca
atattggatggctattctatttcttctattactatccgttacaaggttcaaggcaagaat
gaagaccagcacgttgatgtgaagataaagaatgccaccatcactcagtatcagctcaag
ggcctagagcctgaaacagcataccaggtggacatttttgcagagaacaacatagggtca
agcaacccagccttttctcatgaactggtgaccctcccagaatctcaagcaccagcggac
cttggaggggggaagatgctgcttatagccatccttggctctgctggaatgacctgcctg
actgtgctgttggcctttctgatcatattgcaattgaagagggcaaatgtgcaaaggaga
atggcccaagccttccaaaacgtgagggaagaaccagctgtgcagttcaactcaggaact
ctggccctaaacaggaaggtcaaaaacaacccagatcctacaatttatccagtgcttgac
tggaatgacatcaaatttcaagacgtgattggggagggcaattttggccaagttcttaag
gcgcgcatcaagaaggatgggttacggatggatgctgccatcaaaagaatgaaagaatat
gcctccaaagatgatcacagggactttgcaggagaactggaagttctttgtaaacttgga
caccatccaaacatcatcaatctcttaggagcatgtgaacatcgaggctacttgtacctg
gccattgagtacgcgccccatggaaaccttctggacttcctgcgcaagagccgtgtgctg
gagacggacccagcatttgccattgccaatagcactgcgtccacactgtcttcccagcag
ctccttcacttcgctgccgatgtggcccggggcatggactacttgagccaaaaacagttt
atccacagggatctggctgccagaaacattttagttggtgaaaactatgtggcaaaaata
gcagattttggattgtcccgaggtcaagaggtgtatgtgaaaaagacaatgggaaggctc
ccagtgcgctggatggccatcgagtcactgaattacagtgtgtacacaaccaacagtgat
gtatggtcctatggtgtgttactatgggagattgttagcttaggaggcacaccctactgc
gggatgacttgtgcagaactctacgagaagctgccccagggctacagactggagaagccc
ctgaactgtgatgatgaggtgtatgatctaatgagacaatgctggcgggagaagccttat
gagaggccatcatttgcccagatattggtgtccttaaacagaatgttagaggagcgaaag
acctacgtgaataccacgctttatgagaagtttacttatgcaggaattgactgttctgct
gaagaagcggcctag

DBGET integrated database retrieval system