KEGG   Pan paniscus (bonobo): 100982532
Entry
100982532         CDS       T02283                                 

Gene name
RAP2A
Definition
(RefSeq) RAP2A, member of RAS oncogene family
  KO
K07837  Ras-related protein Rap-2A
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pps04031]
    100982532 (RAP2A)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    100982532 (RAP2A)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N TPP_enzyme_M MMR_HSR1_Xtn AAA_24
Other DBs
NCBI-GeneID: 100982532
NCBI-ProteinID: XP_003832085
UniProt: A0A2R8ZLW6
Position
13
AA seq 183 aa
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDL
ESEREVSSNEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSAC
NIQ
NT seq 552 nt   +upstreamnt  +downstreamnt
atgcgcgagtacaaagtggtggtgctgggctcgggcggggtaggcaaatccgccctgacc
gtgcagttcgtgaccggcaccttcatcgagaaatacgaccccaccatcgaggacttctac
cgcaaggagatcgaggtggattcgtcgccgtcggtgctggagatcctggacacggcgggc
accgagcagttcgcgtccatgcgggacctgtacatcaagaacggccagggcttcatcctc
gtctacagcctcgtcaaccagcagagcttccaggacatcaagcccatgcgggaccagatc
atccgcgtgaagcggtatgagaaagtgccagtcatcttggttgggaacaaagtggacctg
gaaagtgagagagaagtatcgtccaacgaaggcagagcccttgctgaagagtggggctgc
ccctttatggaaacttccgctaagagtaaaacaatggtggacgaactctttgcagaaatt
gtgaggcagatgaactatgctgctcagcctgacaaagatgacccatgctgttctgcatgt
aacatacaatag

DBGET integrated database retrieval system