KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22625
Entry
UIB01_22625       CDS       T03366                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu00627  Aminobenzoate degradation
pstu00633  Nitrotoluene degradation
pstu00642  Ethylbenzene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UIB01_22625
   00633 Nitrotoluene degradation
    UIB01_22625
   00642 Ethylbenzene degradation
    UIB01_22625
   00626 Naphthalene degradation
    UIB01_22625
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22625
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     UIB01_22625
    1.14.12.23  nitroarene dioxygenase
     UIB01_22625
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     UIB01_22625
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AHY45194
UniProt: A0A023WZF5
Position
pLIB119:52444..53793
AA seq 449 aa
MNYKNINLVSESGLTQKHLIHGDEELFQRELETIFARNWLFLTHDSLIPSPGDYVTAKMG
VDEVIVSRQNDGSIRAFLNVCRHRGKTLVHAEAGNAKGFVCSYHGWGFGANGELQSVPFE
KELYGEALDKKCMGLKEVARVESFHGFIYGCFDEEAPSLKDYMGDAGWYLEPMFKHSGGL
ELIGPPGKVIIKANWKAPAENFVGDAYHVGWTHAASLRTGQSVFSSLAGNAALPPEGAGL
QMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGEVRARIYRSHLNGTV
FPNNSFLTCSGVFKVWHPIDANTTEVWTYAMVEKDMPEDLKRRLVDAVQRTFGPAGFWES
DDNDNMETESQNAKKYQSRDGDLVSNLGFGGDVYGDEVYPGIVGKSAIGETSYRGFYRAY
GAHISSSSWAEFEDVSKNWHTELAKTTDR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaattacaaaaatataaacttggtgagtgaatctgggctgacccaaaaacacctgatt
catggcgacgaagaacttttccagcgcgaactggaaaccatttttgctcggaactggctt
ttcctgactcatgacagcctgattccgtcccctggcgactatgttacggcaaaaatgggg
gttgatgaggttatcgtctccaggcagaacgacggttcgattcgtgctttcctgaacgtt
tgtcgtcaccgtggcaagacgctggtacacgcagaagcaggtaatgctaaaggtttcgtt
tgcagctatcacggctggggcttcggcgctaacggtgaactgcagagcgtcccgtttgaa
aaagaactgtatggcgaggcgctcgacaagaaatgtatgggattgaaagaagtcgctcgt
gtagagagcttccatggcttcatctatggttgcttcgatgaggaagccccttctctcaaa
gactacatgggggacgctggctggtacctggagcctatgtttaagcattccggagggcta
gaactgatcggtcctccaggcaaggtcataatcaaggctaactggaaagcgcccgcggaa
aactttgtgggggatgcgtaccacgtgggttggacgcatgcggcttcgcttcgcacaggg
cagtcggtcttctcgtcgttagctggcaacgcagctttgcccccagaaggtgcaggtctg
caaatgacctccaaatacggcagcggcatgggtgtgttgtgggacggatattcaggcgtg
cacagcgcagacctggttccggaattgatggccttcggcggtgctaagcaggaacggctg
aacaaagaaattggcgaggttcgcgcacgaatctatcgtagccacctcaacggcaccgtt
ttcccgaacaacagttttctgacctgctcgggtgtcttcaaggtatggcacccgatcgac
gcaaataccactgaggtatggacctacgccatggtcgaaaaagacatgcccgaggatctc
aagcgccgcttggtcgacgcggttcagagaacgtttgggcctgctggcttctgggaaagc
gacgacaacgacaatatggaaacggaatcgcaaaacgccaagaaatatcagtccagagat
ggcgatctggtttccaacctgggtttcggcggggacgtatacggcgacgaggtttatcct
ggcatcgtcggcaaatcggcgattggcgagaccagttatcgtggcttctatcgggcttac
ggcgcgcacatcagcagctctagctgggctgaattcgaggatgtctctaaaaattggcat
accgaactggcaaagactactgatcgctaa

DBGET integrated database retrieval system