KEGG   Pan troglodytes (chimpanzee): 451034
Entry
451034            CDS       T01005                                 

Gene name
ARNTL
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 1 isoform X22
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04710  Circadian rhythm
ptr04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    451034 (ARNTL)
  09159 Environmental adaptation
   04710 Circadian rhythm
    451034 (ARNTL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    451034 (ARNTL)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    451034 (ARNTL)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 451034
NCBI-ProteinID: XP_009458248
Ensembl: ENSPTRG00000003376
VGNC: 1622
UniProt: K7B3B1 A0A6D2X2X0
Position
11
AA seq 583 aa
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCN
AMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVG
CDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAK
TGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIH
STGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSR
HAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNC
YKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSM
DSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLN
ITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDM
IDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgattaatatagaaagcatggacacagacaaagatgaccctcatggaaggttagaatat
acagaacaccaaggaaggataaaaaatgcaagggaagctcacagtcagattgaaaagcgg
cgtcgggataaaatgaacagttttatagatgaattggcttctttggtaccaacatgcaac
gcaatgtccaggaaattagataaacttactgtgctaaggatggctgttcagcacatgaaa
acgttaagaggtgccaccaatccatacacagaagcaaactacaaaccaacttttctatca
gacgatgaattgaaacacctcattctcagggcagcagatggatttttgtttgtcgtagga
tgtgaccgagggaagatactctttgtctcagagtctgtcttcaagatcctcaactacagc
cagaatgatctgattggtcagagtttgtttgactacctgcatcctaaagatatcgccaaa
gtcaaggagcagctctcctcctctgacaccgcaccccgggagcggctcatagatgcaaaa
actggacttccagttaaaacagatataacccctgggccatctcgattatgttctggagca
cgacgttctttcttctgtaggatgaagtgtaacaggccttcagtaaaggttgaagacaag
gacttcccctctacctgctcaaagaaaaaagcagatcgaaaaagcttctgcacaatccac
agcacaggctatttgaaaagctggccacccacaaagatggggctggatgaagacaacgaa
ccagacaatgaggggtgtaacctcagctgcctcgtcgcaattggacgactgcattctcat
gtagttccacaaccagtgaacggggaaatcagggtgaaatctatggaatatgtttctcgg
cacgcgatagatggaaagtttgtttttgtagaccagagggcaacagctattttggcatat
ttaccacaagaacttctaggcacgtcgtgttatgaatattttcaccaagatgacatagga
catcttgcagaatgtcataggcaagttttacagacaagagaaaaaattacaactaattgc
tataaatttaaaatcaaagatggttcttttatcacactacggagtcgatggttcagtttc
atgaacccttggaccaaggaagtagaatatattgtctcaactaacactgttgttttagcc
aacgtcctggaaggcggggacccaaccttcccacagctcacagcatccccccacagcatg
gacagcatgctgccctctggagaaggtggcccaaagaggacccatcccactgttccaggg
attccagggggaacccgggctggggcaggaaaaataggccgaatgattgctgaggaaatc
atggaaatccacaggataagagggtcatcgccttctagctgtggctccagcccattgaac
atcacgagtacgcctccccctgatgcctcttctccaggaggcaagaagattttaaatgga
gggactccagacattccttccagtggcctactatcaggccaggctcaggagaacccaggt
tatccatattctgatagttcttctattcttggtgagaacccccacataggtatagacatg
attgacaacgaccaaggatcaagtagtcccagtaatgatgaggcagcaatggctgtcatc
atgagcctcttggaagcagatgctggactgggtggccctgttgactttagtgacttgcca
tggccgctgtaa

DBGET integrated database retrieval system