KEGG   Pan troglodytes (chimpanzee): 453583
Entry
453583            CDS       T01005                                 

Gene name
ARNT2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2 isoform X1
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    453583 (ARNT2)
   05202 Transcriptional misregulation in cancer
    453583 (ARNT2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    453583 (ARNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    453583 (ARNT2)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    453583 (ARNT2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 453583
NCBI-ProteinID: XP_016782765
Ensembl: ENSPTRG00000007363
VGNC: 14625
UniProt: K7B2L7 A0A6D2VST9
Position
15
AA seq 717 aa
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGI
GTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQW
QSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggcaaccccggcggcggtcaaccctccggaaatggcttcagacatacctggatctgtg
acgttgcccgttgcccccatggcggccaccggacaggtgaggatggcgggggccatgcct
gcccgtggaggaaagcggcgttccggaatggacttcgatgatgaagatggtgaaggcccc
agtaaattttcaagagagaatcatagtgaaatcgaaaggcgcagacggaacaagatgact
cagtacatcacggagctctccgacatggtccccacatgcagcgcactggctcggaagcca
gacaagctcaccatcctccgcatggccgtctcgcacatgaagtccatgaggggtacaggg
aacaagtccaccgatggcgcgtacaagccttccttcctcacagagcaggaactgaagcat
ctcatccttgaagcagctgatggatttctgtttgtggtggctgctgagacagggcgagtg
atttatgtgtctgactccgtcacccctgttctgaaccagccccagtcagagtggtttggg
agcacactgtatgaacaggtgcatcctgatgacgtggagaagctgagagagcaactgtgc
acctcagaaaactcaatgacaggccggatcttggacctgaagactgggacggtcaagaaa
gaagggcagcagtcatccatgaggatgtgcatgggctcgcggcggtctttcatctgcagg
atgaggtgtggaaatgctcctttggaccaccttcctctaaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtgaaagaaggagaagcccaatatgctgtggtc
cactgcacaggttacatcaaggcctggccaccagcaggaatgaccatacctgaagaagac
gctgatgtgggacaaggcagtaaatattgcctcgtggcaattgggagactccaggtgacc
agctctcctgtatgcatggacatgaatgggatgtcggtgcccacagagttcttatcccgg
cataactccgatggaatcatcacgtttgtggatccaagatgtatcagtgtgattggctac
caaccccaggatcttctgggaaaggacattttggaattctgccaccctgaggatcaaagc
catctgcgtgagagcttccagcaggtggttaagctgaaaggccaagtcctgtcggtcatg
tatcgatttcgcaccaagaaccgggagtggatgttgatccgcaccagcagcttcacattc
cagaatccctattctgatgagattgagtacatcatctgcaccaacaccaacgtcaagcaa
cttcagcaacagcaggcagaattagaagtgcaccagagagatggattgtcatcgtatgac
ttatcccaggtccctgtccccaacctaccagccggtgttcacgaggccgggaagtccgtg
gaaaaggcggatgcaatcttctcccaggaaagagatcctcggtttgctgaaatgtttgca
ggaattagtgcatcggagaagaagatgatgagctcagcctctgcagcaggaacccagcag
atctactcccaaggaagcccatttccctctggacactccgggaaggccttcagctcttca
gtggttcatgtgcctggagtgaatgatattcagtcctcttcttccacgggccagaacatg
tcccaaatctcccggcagctaaaccagagtcaggtggcgtggacagggagtcgtccgccc
tttccgggacagcaaatcccatctcagtccagcaagactcagtcatctccctttgggatt
ggaacgagccacacctacccggcagacccctcttcctacagccccctctccagcccagct
acctcctcgccaagtgggaatgcctactccagtcttgccaacaggactccagggttcgct
gaaagtggacaaagtagcgggcagttccaagggcggccctcggaagtctggtcgcagtgg
caaagccagcaccatggccagcagagcggtgagcagcactcccaccagcagcccggtcag
actgaagtgttccaggacatgctgcccatgccgggagatccaacccaggggactggcaac
tataacatcgaagactttgccgacctgggcatgtttccaccattttctgagtag

DBGET integrated database retrieval system