KEGG   Pan troglodytes (chimpanzee): 460837
Entry
460837            CDS       T01005                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X7
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr05200  Pathways in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    460837 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    460837 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    460837 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    460837 (MECOM)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    460837 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED zf-C2H2_11 zf-met Zn-ribbon_8 PyrI_C
Other DBs
NCBI-GeneID: 460837
NCBI-ProteinID: XP_003310138
Ensembl: ENSPTRG00000015601
VGNC: 2041
UniProt: A0A6D2Y8J5 A0A2J8P1L6
Position
3
AA seq 1051 aa
MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQ
KLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKH
PSVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESD
KEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASI
AEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPG
EVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTPATSQDQPLDLSMGSRSRASGTKL
TEPRKNHVFGGKKGSNVESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYL
RPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPNA
LPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHV
RNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKE
DAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLD
EEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALD
HIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKES
LHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3156 nt   +upstreamnt  +downstreamnt
atgaagagcgaagactatccccatgaaactatggcgccggatatccacgaagaacggcaa
tatcgctgtgaagactgtgaccagctctttgaatctaaggctgaactagcagatcaccaa
aagtttccatgcagtactcctcactcagcattttcaatggttgaagaggactttcagcaa
aaactcgaaagcgagaatgatctccaagagatacacacgatccaggagtgtaaggaatgt
gaccaagtttttcctgatttgcaaagcctggagaaacacatgctgtcacatactgaagag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaaggttttc
acggaccctagcaaccttcagcggcacattcgctctcagcatgtcggtgcccgggcccat
gcatgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaacacaagcac
atccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcagttt
tcaaacctttgccgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgtgag
ggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctggaacc
ccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgctgac
tattttggcgccaataggcatcctgctggtcttacctttccaacagctcctggattttct
tttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacctgct
agttctcctgttaaaggactatcaagtactgaacagacaaacaaaagtcaaagtcccctc
atgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaacac
ccatctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagagagg
ccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacacca
agtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagtgat
aaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcagaat
ctggcttcaataaataataagaaagaatacagcaatcattccattttctcaccatcttta
gaggagcagactgcggtgtcaggagctgtgaatgattctataaaggctattgcttctatt
gctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttggagct
ttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatgtac
ccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaatcaccaggt
gaagtaaagaaactgcagaagggcagctctgagtccccctttgatctcaccactaagcga
aaggacgagaagcccttgactccagtcccctccaagcctccagtgacacctgccacaagc
caagaccagcccctggatctaagtatgggcagtaggagtagagccagtgggacaaagctg
actgagcctcgaaaaaaccacgtgtttgggggaaaaaaaggaagcaacgtcgaatcaaga
cctgcttcagatggttccttgcagcatgcaagacccactcctttctttatggaccctatt
tacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagagaaatacttg
aggccttctccaggattcttgtttcacccacaattccaactgcctgatcagagaacttgg
atgtcagctattgaaaacatggcagaaaagctagagagcttcagtgccctgaaacctgag
gccagtgagctcttacagtcagtgccctctatgttcaacttcagggcgcctcccaatgcc
ctgccagagaaccttctgcggaagggaaaggagcgctatacctgcagatactgtggcaag
atttttccaaggtctgcaaacctaacacggcacttgagaacccacacaggagagcagcct
tacagatgcaaatactgtgacagatcatttagcatatcttctaacttgcaaaggcatgtt
cgcaacatccacaataaagagaagccatttaagtgtcacttatgtgataggtgttttggt
caacaaaccaatttagacagacacctaaagaaacatgagaatgggaacatgtccggtaca
gcaacatcatcgcctcattctgaactggaaagtacaggtgcgattctggatgacaaagaa
gatgcttacttcacagaaattcgaaatttcattgggaacagcaatcatggcagccaatct
cccaggaatgtggaggagagaatgaatggcagtcattttaaagatgaaaaggctttggtg
accagtcaaaattcagacttgctggatgatgaagaagttgaagatgaggtgttgttagat
gaggaggatgaagacaatgatattactggaaaaacaggaaaggaaccagtgacaagtaat
ttacatgaaggaaaccctgaggatgactatgaagaaaccagtgccctggagatgagttgc
aagacatccccagtgaggtataaagaggaagaatataaaagtggactttctgctctagat
catataaggcacttcacagatagcctcaaaatgaggaaaatggaagataatcagtattct
gaagctgagctgtcttcttttagtacttcccatgtgccagaggaacttaagcagccgtta
cacagaaagtccaaatcgcaggcatatgctatgatgctgtcactgtctgacaaggagtcc
ctccattctacatcccacagttcttccaacgtgtggcacagtatggccagggctgcggcg
gaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system