KEGG   Pan troglodytes (chimpanzee): 465358
Entry
465358            CDS       T01005                                 

Gene name
ARNTL2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 2 isoform X9
  KO
K09099  aryl hydrocarbon receptor nuclear translocator-like protein 2
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    465358 (ARNTL2)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    465358 (ARNTL2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 465358
NCBI-ProteinID: XP_003313823
Ensembl: ENSPTRG00000004788
VGNC: 4935
UniProt: A0A6D2WPP2 A0A2I3RZE6
Position
12
AA seq 598 aa
MAAEEEAAAGGEVAGGEATAPGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFP
RKRKGSDSDPSQEAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHL
RSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNY
DQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHTGRTRVYSG
SRRSFFCRIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSK
KDNSNFTCLVAIGRLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQ
ELLGTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNP
WTKELEYIVSVNTLVLGHSEPGEASFFPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIG
TDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKELFPPSPEMGELEATRQN
QSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggcggcggaagaggaggctgcggcgggaggtgaggttgccggtggcgaggcgacggcc
ccaggtaaagtgttgagagaggagaaccagtgcattgctcctgtggtttccagccgcgtg
agtccagggacaagaccaacagctatggggtctttcagctcacacatgacagagtttcca
cgaaaacgcaaaggaagtgattcagacccatcccaagaagctcatagccaaactgaaaag
cggaggagagataaaatgaataacctgattgaagaactgtctgcaatgatccctcagtgc
aaccccatggcgcgtaaactggacaaacttacagttttaagaatggctgttcaacacttg
agatctttaaaaggcttgacaaattcttatgtgggaagtaattatagaccatcatttctt
caggataatgagctcagacatttaatccttaagactgcagaaggcttcttatttgtggtt
ggatgtgaaagaggaaaaattctcttcgtttctaagtcagtctccaaaatacttaattat
gatcaggctagtttgactggacaaagcttatttgacttcttacatccaaaagatgttgcc
aaagtaaaggaacaactttcttcttttgatatttcaccaagagaaaagctaatagatgcc
aaaactggtttgcaagttcacagtaatctccacactggaaggacacgtgtgtattctggc
tcaagacgatcttttttctgtcggataaagagttgtaaaatctctgtcaaagaagagcat
ggatgcttacccaactcaaagaagaaagagcacagaaaattctatactatccattgcact
ggttacttgagaagctggcctccaaatattgttggaatggaagaagaaaggaacagtaag
aaagacaacagtaattttacctgccttgtggccattggaagattacagccatatattgtt
ccacagaacagtggagagattaatgtgaaaccaactgaatttataacccggtttgcagtg
aatggaaaatttgtctatgtagatcaaagggcaacagcgattttaggatatctgcctcag
gaacttttgggaacttcttgttatgaatattttcatcaagatgaccacaataatttgact
gacaagcacaaagcagttctacagagtaaggagaaaatacttacagattcctacaaattc
agagcaaaagatggctcctttgtaactttaaaaagccaatggtttagtttcacaaatcct
tggacgaaagaactggaatatattgtatctgtcaacactttagttttgggacatagtgag
cctggagaagcatcattttttccttgtagctctcaatcatcagaagaatcctctagacag
tcttgtatgagtgtacctggaatgtctactggaacagtacttggtgctggtagtattgga
acagatattgcaaatgaaattctggatttacagaggttacagtcttcttcataccttgat
gattcgagtccaacaggtttaatgaaagatactcatactgtaaactgcaggagtatgtca
aataaggagttgtttccaccaagtcctgaaatgggggagctagaggctaccaggcaaaac
cagagtactgttgctgtccacagccatgagccactcctcagtgatggtgcacagttggat
ttcgatgccctatgtgacaatgatgacacagccatggctgcatttatgaattacttagaa
gcagaggggggcctgggagaccctggggacttcagtgacatccagtggaccctctag

DBGET integrated database retrieval system