KEGG   Pan troglodytes (chimpanzee): 473387
Entry
473387            CDS       T01005                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04062  Chemokine signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04137  Mitophagy - animal
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04540  Gap junction
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04625  C-type lectin receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04714  Thermogenesis
ptr04720  Long-term potentiation
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr05010  Alzheimer disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05034  Alcoholism
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05207  Chemical carcinogenesis - receptor activation
ptr05208  Chemical carcinogenesis - reactive oxygen species
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05216  Thyroid cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    473387 (KRAS)
   04012 ErbB signaling pathway
    473387 (KRAS)
   04014 Ras signaling pathway
    473387 (KRAS)
   04015 Rap1 signaling pathway
    473387 (KRAS)
   04370 VEGF signaling pathway
    473387 (KRAS)
   04371 Apelin signaling pathway
    473387 (KRAS)
   04068 FoxO signaling pathway
    473387 (KRAS)
   04072 Phospholipase D signaling pathway
    473387 (KRAS)
   04071 Sphingolipid signaling pathway
    473387 (KRAS)
   04151 PI3K-Akt signaling pathway
    473387 (KRAS)
   04150 mTOR signaling pathway
    473387 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    473387 (KRAS)
   04137 Mitophagy - animal
    473387 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    473387 (KRAS)
   04218 Cellular senescence
    473387 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    473387 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    473387 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    473387 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    473387 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    473387 (KRAS)
   04660 T cell receptor signaling pathway
    473387 (KRAS)
   04662 B cell receptor signaling pathway
    473387 (KRAS)
   04664 Fc epsilon RI signaling pathway
    473387 (KRAS)
   04062 Chemokine signaling pathway
    473387 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    473387 (KRAS)
   04929 GnRH secretion
    473387 (KRAS)
   04912 GnRH signaling pathway
    473387 (KRAS)
   04915 Estrogen signaling pathway
    473387 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    473387 (KRAS)
   04917 Prolactin signaling pathway
    473387 (KRAS)
   04921 Oxytocin signaling pathway
    473387 (KRAS)
   04926 Relaxin signaling pathway
    473387 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    473387 (KRAS)
   04919 Thyroid hormone signaling pathway
    473387 (KRAS)
   04916 Melanogenesis
    473387 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    473387 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    473387 (KRAS)
   04726 Serotonergic synapse
    473387 (KRAS)
   04720 Long-term potentiation
    473387 (KRAS)
   04730 Long-term depression
    473387 (KRAS)
   04722 Neurotrophin signaling pathway
    473387 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    473387 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    473387 (KRAS)
   04213 Longevity regulating pathway - multiple species
    473387 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    473387 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    473387 (KRAS)
   05206 MicroRNAs in cancer
    473387 (KRAS)
   05205 Proteoglycans in cancer
    473387 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    473387 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    473387 (KRAS)
   05203 Viral carcinogenesis
    473387 (KRAS)
   05230 Central carbon metabolism in cancer
    473387 (KRAS)
   05231 Choline metabolism in cancer
    473387 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    473387 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    473387 (KRAS)
   05212 Pancreatic cancer
    473387 (KRAS)
   05225 Hepatocellular carcinoma
    473387 (KRAS)
   05226 Gastric cancer
    473387 (KRAS)
   05214 Glioma
    473387 (KRAS)
   05216 Thyroid cancer
    473387 (KRAS)
   05221 Acute myeloid leukemia
    473387 (KRAS)
   05220 Chronic myeloid leukemia
    473387 (KRAS)
   05218 Melanoma
    473387 (KRAS)
   05211 Renal cell carcinoma
    473387 (KRAS)
   05219 Bladder cancer
    473387 (KRAS)
   05215 Prostate cancer
    473387 (KRAS)
   05213 Endometrial cancer
    473387 (KRAS)
   05224 Breast cancer
    473387 (KRAS)
   05223 Non-small cell lung cancer
    473387 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    473387 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    473387 (KRAS)
   05161 Hepatitis B
    473387 (KRAS)
   05160 Hepatitis C
    473387 (KRAS)
   05163 Human cytomegalovirus infection
    473387 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    473387 (KRAS)
   05165 Human papillomavirus infection
    473387 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    473387 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    473387 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    473387 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    473387 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    473387 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    473387 (KRAS)
   01522 Endocrine resistance
    473387 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    473387 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ptr04031]
    473387 (KRAS)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    473387 (KRAS)
GTP-binding proteins [BR:ptr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    473387 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 473387
NCBI-ProteinID: XP_003313842
Ensembl: ENSPTRG00000004775
VGNC: 10375
UniProt: A0A2I3T6U4 A0A6D2WV88
Position
12:61085647..61131290
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

  All links  
Ontology (3)   
   KEGG BRITE (3)   
Pathway (83)   
   KEGG PATHWAY (83)   
Genome (1)   
   KEGG GENOME (1)   
Gene (6)   
   KEGG ORTHOLOGY (1)   
   NCBI-PROTEINID (1)   
   NCBI-Gene (1)   
   Ensembl (1)   
   OC (1)   
   VGNC (1)   
Protein sequence (6)   
   UniProt (2)   
   RefSeq(pep) (4)   
DNA sequence (24)   
   RefSeq(nuc) (4)   
   GenBank (10)   
   EMBL (10)   
Protein domain (9)   
   Pfam (9)   
All databases (132)   

Download RDF
DBGET integrated database retrieval system