KEGG   Quercus suber (cork oak): 112031698Help
Entry
112031698         CDS       T05868                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00601  Glycosphingolipid biosynthesis - lacto and neolacto series
qsu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    112031698
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    112031698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:qsu01003]
    112031698
Enzymes [BR:qsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     112031698
Glycosyltransferases [BR:qsu01003]
 Glycan extension
  P blood group
   112031698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug TcdA_TcdB Caps_synth Cuticle_2
Motif
Other DBs
NCBI-GeneID: 112031698
NCBI-ProteinID: XP_023920177
Position
Unknown
AA seq 420 aa AA seqDB search
MVRKFIKAKMFDYQVLSRAKFPLFFTITLAGMIFIIYTDSIIYNSFEFSNNENFKVLEAH
ERTERQLRSSNGNMSMQEEIDEVEDENWKSLVPPLSATEEQRIAWFREKMPKFEILKSNN
LTRLFHSRVKEFFNSGCETQFFITWISPAGSFGRREFFMLESLFDAHPSACLMILSRSMD
SGRGHRILKPLADRGFKVNAVTPDLAFLFNNTPAEAWFKEMKSGNKDPGEIPLAQNLSNL
IRLAVLYRYGGVYLDTDFIVLKPFTRLKNSIGAQSMDMETKNWTRLNNAVLIFDMNHPLL
LKFMEEFASTFDGNKWGHNGPYLVSRVVENIGKQPGYNFTVLHPMAFYPVDWIRISRLFM
KPANRYDSRWVQDKLLQLSGETYGVHLWNKQTRNLRIEEGSVMGSLILEHCLLCQHVYSF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaaaattcatcaaggctaagatgtttgattaccaggtacttagccgtgccaaa
tttcctctcttttttaccatcacacttgctggcatgatctttatcatctacacagacagt
atcatatataattcttttgagtttagtaataatgaaaattttaaggtcttggaggctcat
gagagaactgaaagacaactgagatcaagtaatggtaacatgtccatgcaagaagagata
gatgaagttgaagatgaaaattggaaatctttagtccctcctttgagtgccacagaagaa
caaagaattgcttggttccgggaaaagatgccaaagtttgagattttaaagtcaaacaac
ttgacacggctgtttcatagtcgggttaaggaattctttaacagtggttgtgagacacag
ttcttcataacttggatttcaccagcagggtcttttggaagaagagaattcttcatgttg
gagagccttttcgacgcacacccttctgcatgtttaatgattctgtcaagaagtatggac
tctggaagagggcatagaattttgaaacctctagctgatagaggattcaaagttaatgca
gtgacaccggacttggcatttcttttcaataataccccagctgaagcttggtttaaggag
atgaagagtgggaacaaggaccctggtgagattccattagctcagaatttatccaatttg
atcagacttgcagtattgtacaggtatggtggggtttacttggatacagattttattgtt
ctaaagccttttaccaggttgaagaactcaattggtgcacaaagtatggatatggaaact
aagaactggaccaggttaaacaatgcagttttgatttttgatatgaatcatccacttctg
ctcaaattcatggaggaattcgcctcgacttttgatggaaataaatggggtcataatggt
ccctatttggtttctagagtggttgagaatataggaaagcaacctggttataacttcaca
gtcttgcatcccatggccttctatccggttgattggattaggataagcaggctttttatg
aagccagcaaaccgttatgattctagatgggtacaagacaaactgcttcagctcagtgga
gagacttatggggtacacctatggaacaagcaaacccgtaatttgcgaatcgaagaagga
agtgtcatgggaagtctaatcctagagcactgtctcctttgccaacacgtatatagtttc
taa

DBGET integrated database retrieval system