KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108536550
Entry
108536550         CDS       T04641                                 

Definition
(RefSeq) cytochrome P450 11B2, mitochondrial
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00140  Steroid hormone biosynthesis
rbb01100  Metabolic pathways
rbb04925  Aldosterone synthesis and secretion
Module
rbb_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    108536550
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    108536550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rbb00199]
    108536550
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     108536550
    1.14.15.5  corticosterone 18-monooxygenase
     108536550
Cytochrome P450 [BR:rbb00199]
 Cytochrome P450, animal type
  CYP11 family
   108536550
SSDB
Motif
Pfam: p450 DUF765
Other DBs
NCBI-GeneID: 108536550
NCBI-ProteinID: XP_017738873
UniProt: A0A2K6JTQ3
Position
Un
AA seq 503 aa
MALRAKAEVCMAAPWLSLQRAQALSTRASRAPSTVLPFEAIPQRPGNRWLRLLQIWREQG
YEHLHLELHQTFQELGPIFRYHLGGPRMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDTVARDFSQALRKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQHYTGIVAELLLNAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNPAVFPRP
ERYNPQRWLDIRGSGKNFHNVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPSTFPLLTFRAIN
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcatggcagcaccctggctgtccctgcaaagg
gcacaggcactaagcactagagcctctcgggcccccagtaccgtgctgccctttgaagcc
ataccccagcgtccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgagcacctgcacctggagctgcaccagaccttccaggaactggggcccattttcagg
taccacttgggaggaccacgcatggtgtgtgtgatgctgccggaggacgtggagaagcta
cagcaggtggacagcctgcatccccacaggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgctgaatgggcctgaatggcgcttcaat
cgattgcggctgaacccagatgtgctgtcgcccaaggccgtgcagaggttcctcccgatg
gtggacacagtggccagggacttctcccaggccctgaggaagaaggtgctgcagaacgcc
cgggggagcctgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttagctctttttggagagcggctgggcctggttggccacagccccagctctgccagc
ctgaacttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggaccagccccaaggtgtggaaggagcactttgaggcctgg
gactgcatcttccagtacggcgacaactgtatccagaaaatctatcaggaactggctttc
agccgccctcaacactacacaggcatcgtggcggaactcctgttgaatgcagaactgtca
ctagaagccatcaaggccaactctatggaactcactgcagggagcgtggacacgactgcg
tttcctttgctgatgacactctttgagctggctcggaacccggacgtgcagcaggccctg
cgccaggagagcctggccgccgctgccagcatcagtgaacatccccagaaggcaaccacc
gagctgcccttgctgcgggcggccctcaaggagaccttgaggctctaccctgtgggtctg
tttttggagcgagtggtgagctcagacttggtgcttcagaactaccacatcccagctggg
acattggtgcaggttttcctctactcgctgggtcgcaaccccgccgtgttcccgaggcct
gagcgctataatccccagcgctggctagacatcaggggctctggaaagaacttccacaac
gtgccctttggctttggcatgcgccagtgcctggggcggcgcctggcagaagcggagatg
ctgctgctgctgcaccatgtgctgaaacacttcctggtggagacactaacccaagaggat
ataaagatggtctacagcttcatattgaggcccagcacgttccccctcctcactttcaga
gcgatcaactag

DBGET integrated database retrieval system