GenomeNet

Database: RefSeq
Entry: NC_003065
LinkDB: NC_003065
Original site: NC_003065 
LOCUS       NC_003065             214233 bp    DNA     circular CON 31-JUL-2020
DEFINITION  Agrobacterium fabrum str. C58 plasmid Ti, complete sequence.
ACCESSION   NC_003065 NZ_AE007923-NZ_AE007942 NZ_AE008690
            NZ_AE009418-NZ_AE009438
VERSION     NC_003065.3
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603108
            Assembly: GCF_000092025.1
KEYWORDS    RefSeq.
SOURCE      Agrobacterium fabrum str. C58
  ORGANISM  Agrobacterium fabrum str. C58
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium;
            Agrobacterium tumefaciens complex.
REFERENCE   1  (bases 1 to 214233)
  AUTHORS   Goodner,B., Hinkle,G., Gattung,S., Miller,N., Blanchard,M.,
            Qurollo,B., Goldman,B.S., Cao,Y., Askenazi,M., Halling,C.,
            Mullin,L., Houmiel,K., Gordon,J., Vaudin,M., Iartchouk,O., Epp,A.,
            Liu,F., Wollam,C., Allinger,M., Doughty,D., Scott,C., Lappas,C.,
            Markelz,B., Flanagan,C., Crowell,C., Gurson,J., Lomo,C., Sear,C.,
            Strub,G., Cielo,C. and Slater,S.
  TITLE     Genome sequence of the plant pathogen and biotechnology agent
            Agrobacterium tumefaciens C58
  JOURNAL   Science 294 (5550), 2323-2328 (2001)
   PUBMED   11743194
REFERENCE   2  (bases 1 to 214233)
  AUTHORS   Wood,D.W., Setubal,J.C., Kaul,R., Monks,D.E., Kitajima,J.P.,
            Okura,V.K., Zhou,Y., Chen,L., Wood,G.E., Almeida,N.F. Jr., Woo,L.,
            Chen,Y., Paulsen,I.T., Eisen,J.A., Karp,P.D., Bovee,D. Sr.,
            Chapman,P., Clendenning,J., Deatherage,G., Gillet,W., Grant,C.,
            Kutyavin,T., Levy,R., Li,M.J., McClelland,E., Palmieri,A.,
            Raymond,C., Rouse,G., Saenphimmachak,C., Wu,Z., Romero,P.,
            Gordon,D., Zhang,S., Yoo,H., Tao,Y., Biddle,P., Jung,M.,
            Krespan,W., Perry,M., Gordon-Kamm,B., Liao,L., Kim,S., Hendrick,C.,
            Zhao,Z.Y., Dolan,M., Chumley,F., Tingey,S.V., Tomb,J.F.,
            Gordon,M.P., Olson,M.V. and Nester,E.W.
  TITLE     The genome of the natural genetic engineer Agrobacterium
            tumefaciens C58
  JOURNAL   Science 294 (5550), 2317-2323 (2001)
   PUBMED   11743193
REFERENCE   3  (bases 1 to 214233)
  AUTHORS   Hinkle,G., Slater,S.C. and Goodner,B.
  TITLE     Complete Genome Sequence of Agrobacterium tumefaciens C58
            (Rhizobium radiobacter C58), the Causative Agent of Crown Gall
            Disease in Plants
  JOURNAL   Unpublished
REFERENCE   4  (bases 1 to 214233)
  AUTHORS   Slater,S.C., Setubal,J.C., Zhao,Y., Goodner,B., Houmiel,K., Sun,J.,
            Kaul,R., Goldman,B., Chen,Q., Huang,W.Mun., Casjens,S., Farrand,S.,
            Burr,T., Nester,E., Kadoi,R., Ostheimer,T., Pride,N., Sabo,A.,
            Henry,E., Telepak,E. and Wood,D.
  CONSRTM   agrobacterium.org
  TITLE     Direct Submission
  JOURNAL   Submitted (30-OCT-2007) Virginia Bioinformatics institute, Virginia
            Polytechnic Institute and State University, Washington Street Box
            0477, Blacksburg, VA 24060, USA
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 214233)
  AUTHORS   Hinkle,G., Slater,S.C. and Goodner,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2001) Cereon Genomics, 45 Sidney Street,
            Cambridge, MA 02139, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AE007871.
            On or before Nov 7, 2007 this sequence version replaced
            NC_003308.1, NC_003065.2.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/10/2020 10:53:47
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,322
            CDSs (total)                      :: 5,251
            Genes (coding)                    :: 5,160
            CDSs (with protein)               :: 5,160
            Genes (RNA)                       :: 71
            rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
            complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
            tRNAs                             :: 53
            ncRNAs                            :: 6
            Pseudo Genes (total)              :: 91
            CDSs (without protein)            :: 91
            Pseudo Genes (ambiguous residues) :: 0 of 91
            Pseudo Genes (frameshifted)       :: 38 of 91
            Pseudo Genes (incomplete)         :: 55 of 91
            Pseudo Genes (internal stop)      :: 20 of 91
            Pseudo Genes (multiple problems)  :: 18 of 91
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..214233
                     /organism="Agrobacterium fabrum str. C58"
                     /mol_type="genomic DNA"
                     /strain="C58"
                     /culture_collection="ATCC:33970"
                     /type_material="type strain of Agrobacterium fabrum"
                     /db_xref="taxon:176299"
                     /plasmid="Ti"
     gene            complement(387..1502)
                     /locus_tag="ATU_RS23005"
                     /old_locus_tag="AGR_pTi_39"
                     /old_locus_tag="Atu6000"
     CDS             complement(387..1502)
                     /locus_tag="ATU_RS23005"
                     /old_locus_tag="AGR_pTi_39"
                     /old_locus_tag="Atu6000"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="agrocinopine synthase"
                     /protein_id="WP_010974816.1"
                     /translation="MYNLGKGVQECTETSLLTALGGMERRNLSELDTTLTSDNLPVVS
                     HDFNTWRISTLPDRLIRELHSADVKNIPVIIREVSNGEITESYTVTNDIIPFLEPLLD
                     KVFDVNPGATFFLDGRDFEAHIITAWLSRRPKYRQRVVLLFYTFEYSSGEAFFDAVKQ
                     VSPEPDWRETVALMPVIFPQELPRLAKLIDLSDIAVEDLYEGGKIWIDSMLRQPMRVV
                     AVHIVMARVKPEQLGLCDKPEIVRAFNADYAAVRLAYYVKDNPEVRKMRPHLKLATAT
                     RCYDFSAQLENGEKAEFSINIRTGRPMPRETDERKYIRRGYGIPGNAAAIADWVISDR
                     SEDEMSFWEWRNKGVPRRVDHHCPHLDVIEQDGKSVP"
     gene            2389..3072
                     /locus_tag="ATU_RS23010"
                     /old_locus_tag="AGR_pTi_bx89"
                     /old_locus_tag="Atu6001"
     CDS             2389..3072
                     /locus_tag="ATU_RS23010"
                     /old_locus_tag="AGR_pTi_bx89"
                     /old_locus_tag="Atu6001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RolB family protein"
                     /protein_id="WP_010891471.1"
                     /translation="MYYERPVFDIVDTWEIREREVLKPVLSVAEEDYCYFVQNTVASA
                     QRSWVDLVANLFNSPDSDIDDALNRFADAPCLHGPTLEPMNLILKGSPMYVYCSFEEM
                     RSCATKRFYEGISNRGVVICTVPPYAEGVTRDDMSVWQNQACVNTCSGKNDLDAYIAF
                     LPTSSLQESSYWHTKNGIYSFLAPSQTDAFCCEILCVGRALFEDRSRKEKLRNCLLKL
                     LNYRLKLLF"
     gene            complement(3528..5099)
                     /locus_tag="ATU_RS23015"
                     /old_locus_tag="AGR_pTi_41"
                     /old_locus_tag="Atu6002"
     CDS             complement(3528..5099)
                     /locus_tag="ATU_RS23015"
                     /old_locus_tag="AGR_pTi_41"
                     /old_locus_tag="Atu6002"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974815.1"
                     /translation="MENQNTPVEAIERKLKSSWLHSLHVRKILPSPFLGGPYSYITEE
                     TDVGQEADCIRGHSVTPLPEDEGMVSHHMQQIFCSTHQPAAHDHVDAFALRAAPEPAV
                     IPDEDIADKSYRPFASSENSLTDILMRMPLSTRNAWATQARKERDDAFRVILELPSLP
                     KEVKKYLRRSAQSIQTQEMRWQLKCHLPLWERGLFWLWLVIMQLAVVLPDIVSASLGA
                     EVAVLRSGPITLQTQLMVLAIFDYPWADTRLAAHLACEVFLGGLPVLIFGLFAIAMPQ
                     HEGTTFHTAKDVAWKASLCILWQMLMQNRKNIRDLLKYSFLRMKRISTAQSSDFTSEY
                     TRLRNSSTIIYSWLDTFEVSNRLRIQIGYHKQDHEDALRVLRWVGHIADDNDRSPRGG
                     KAGILVAILTMAGLICLSTFPTDAYSGLIAAANLVPLAARAAVDVMDNSQSSHDLLRL
                     FTATAGVSFPSTLFVLGNSSYWLLTKKSFLAGFANIHFWIAFVLIFFLSLFPKLWGRL
                     FMYVGSRLLNDRSRA"
     gene            6154..6870
                     /locus_tag="ATU_RS23020"
                     /old_locus_tag="AGR_pTi_42"
                     /old_locus_tag="Atu6003"
     CDS             6154..6870
                     /locus_tag="ATU_RS23020"
                     /old_locus_tag="AGR_pTi_42"
                     /old_locus_tag="Atu6003"
                     /inference="COORDINATES: protein motif:HMM:NF014125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RolB family protein"
                     /protein_id="WP_045231701.1"
                     /translation="MSYNQNMIPSGDDRPVFPTIDLFANTSLEELQQSLCAAVANYRD
                     FLTRKILPFQQSWVVRVLSESGLDEETLRAIKSCVFTPCCSIPGAVQPDRICQHDSPI
                     YIYTSLNLLSQYVEGKTLLRCYRKFVLASSLPPYRTDIPAEELKNVLNSILPGAYSMP
                     HAVSCFVAILPSKKFTISMSKITTRGGAEEHFVVFSREENDIIPYDIVAVGKTLFSQS
                     DEEFGLPNLSFDELQNLIST"
     gene            7578..8273
                     /locus_tag="ATU_RS23025"
                     /old_locus_tag="AGR_pTi_43"
                     /old_locus_tag="Atu6004"
     CDS             7578..8273
                     /locus_tag="ATU_RS23025"
                     /old_locus_tag="AGR_pTi_43"
                     /old_locus_tag="Atu6004"
                     /inference="COORDINATES: protein motif:HMM:NF014125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RolB family protein"
                     /protein_id="WP_010974818.1"
                     /translation="MMVYQRPVFTVISLLRIRNREEAKLVLIGAVVVYRNFVEQTLAD
                     AQKNWVKSLVLYDDPGDAVTGILTWFSRYACLHGPRLGPLDTIAVNDNPLYIYCPRRK
                     LEEYAKERIVSFHSEIGSVVCSMSPFDAGVTREKVRYGHNLISPGSCLLPDALEAYVA
                     FLPSKSFLKLPYSVYEVHNDRYVHKFFALLPGSRFHFEVVAVGLAYPAAKKRPSGLGI
                     LRCCFTGKTNTCL"
     gene            8752..9696
                     /locus_tag="ATU_RS23030"
                     /old_locus_tag="AGR_pTi_45"
                     /old_locus_tag="Atu6005"
     CDS             8752..9696
                     /locus_tag="ATU_RS23030"
                     /old_locus_tag="AGR_pTi_45"
                     /old_locus_tag="Atu6005"
                     /inference="COORDINATES: protein motif:HMM:NF014125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RolB family protein"
                     /protein_id="WP_010974819.1"
                     /translation="MMVPPRPGFAPLSLESINDRMEMHLFLTSACILYHIYIRDNLLI
                     YQEIWTKYWRGRLAESALKNEISALYLRLPFPRPPTLQSIAEQEVICKDAAPIYVYCS
                     REAMLSHVQSKDLCQFGRANLLACTLAPYRTGVTIEMVRCLFKRLRDGNRVEAGTGEE
                     DLSHFVAFLPTTAFRRGPRFYLGGENVQFFLREGGLELPCHIIAFGRALFSEILADGS
                     SWDWKSVGESSRLNHVRASVELSRNVPTAETTDNWAEAALGTDAVYPVRPPNLTPTQD
                     HPCKPLLSGNRVPNERHRPWKRFFKKLRSVSKHFYFNR"
     gene            complement(10349..11353)
                     /locus_tag="ATU_RS23035"
                     /old_locus_tag="AGR_pTi_46"
                     /old_locus_tag="Atu6007"
     CDS             complement(10349..11353)
                     /locus_tag="ATU_RS23035"
                     /old_locus_tag="AGR_pTi_46"
                     /old_locus_tag="Atu6007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018064072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_162993139.1"
                     /translation="MFVENYPDCEKTELFSARVAGALTHARRSNILFVSHGGVLSVVA
                     TLLGVELTAMQRCNACVLHFKFDGSSWNVHTRDSGVILVTGASGGIDKAIDDNLMRRG
                     FRLSLGARSVEKLEATFGFQNESLHFARFEAEDLQTMEEWVSTAMIKFGRIDGLVNNA
                     GDGTRVALAEGIDYEQLERQWKINAGAPLRMIMLCLPQLAKSGSGRIVNIISMSGQRV
                     LNSFVGYNMTKHALSGLTKTAQHVGWESGVRTMEICPGYVATKMSAWTDEIEDDGKIQ
                     PEHIAELVRQAIERPNNAFVPKIEVLCIQQPLAVRSRSKVGGSIVYGPKPRPGCQCAH
                     "
     gene            complement(11591..12697)
                     /locus_tag="ATU_RS23040"
                     /old_locus_tag="AGR_pTi_47"
                     /old_locus_tag="Atu6008"
     CDS             complement(11591..12697)
                     /locus_tag="ATU_RS23040"
                     /old_locus_tag="AGR_pTi_47"
                     /old_locus_tag="Atu6008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_045024010.1"
                     /translation="MFNLGKRIQECTASSLLAALGQGGRNLSELDVCLTSDNVAIVSH
                     DLNTWRVSEKLGDKLFNEIHSSKIKDVPVIIREVSNGIIQDKYLETIDHIPLLTEIFS
                     KVFLANSDATIFLDGRNYEAHVIVAWLSHRPEYHQRVVVLFYTFEYPHGGAFVDAVLN
                     AQPASAWRKSIALMPALFPEELCRLARLRQVTEPTVDDLYLAGKAWFDSMLMQDMRIV
                     AAHVVFSGVTRNLLGQVVDKDVLLAFDSDQAAVRLAYYLKEDTMIRAKRPHLKFAAVT
                     RCYDFAALLDSGERGEFSIDIKTGRARRHETDERKHIRWRKGTPGNSATIADWVISDR
                     PEDEMAIWEWRNQGIDREVSHLSPHLDLNIETSK"
     gene            13461..14126
                     /locus_tag="ATU_RS23045"
                     /old_locus_tag="AGR_pTi_bx83"
                     /old_locus_tag="Atu6009"
     CDS             13461..14126
                     /locus_tag="ATU_RS23045"
                     /old_locus_tag="AGR_pTi_bx83"
                     /old_locus_tag="Atu6009"
                     /inference="COORDINATES: protein motif:HMM:NF014125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RolB family protein"
                     /protein_id="WP_010974822.1"
                     /translation="MYHSRPIFNIIDSSNIQDRRELKLVLRHTEIAYRSFAQEDLIPA
                     QRSWMNSIINTDVPIDPAIDEVVKRFCEVACLPGPAGIPLNIILNDSLTYVYCSFQAM
                     RKYAHKRFYDGVSDEGVVISTVPPYAEGITKETMRSWHNNVCQNTSNETHDLDAYIAF
                     LPTSLQNPSFSHMKIGCDSFLAPSRVDPFCVEIIAVGKALFHDNGLKKNPRCGGQWLP
                     PSC"
     gene            complement(14631..16034)
                     /gene="iaaH"
                     /locus_tag="ATU_RS23050"
                     /old_locus_tag="AGR_pTi_48"
                     /old_locus_tag="Atu6010"
     CDS             complement(14631..16034)
                     /gene="iaaH"
                     /locus_tag="ATU_RS23050"
                     /old_locus_tag="AGR_pTi_48"
                     /old_locus_tag="Atu6010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012649066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indoleacetamide hydrolase"
                     /protein_id="WP_010974823.1"
                     /translation="MVPITSLAQTLERLRRKDYSCLELVETLIARCQAAKPLNALLAT
                     DWDGLRRSAKKIDRHGNAGLGLCGIPLCFKANIATGIFPTSAATPALINHLPKIPSRV
                     AERLFSAGALPGASGNMHELSFGITSNNYATGAVRNPWNPSLIPGGSSGGVAAAVASR
                     LMLGGIGTDTGASVRLPAALCGVVGFRPTLARYPRDRIIPVSPTRDTAGIIAQCVADV
                     IILDQVISGRSAKISPMPLKGLRIGLPTTYFYDDLDADVAFAAETTIRLLANRGVTFV
                     EADIPHLEELNSGASLPIALYEFPHALKKYLDDFVGTVSFSDVIKGIRSPDVANIVSA
                     QIDGHQISNDEYELARQSFRPRLQATYRNYFRLYQLDAILFPTAPLAAKAIGQESSVI
                     HNGSMMNTFKIYVRNVDPSSNAGLPGLSLPACLTPDRLPVGMEIDGLAGSDHRLLAIG
                     AALEKAINFPSFPDAFN"
     gene            16372..18639
                     /locus_tag="ATU_RS23055"
                     /old_locus_tag="AGR_pTi_49"
                     /old_locus_tag="Atu6011"
     CDS             16372..18639
                     /locus_tag="ATU_RS23055"
                     /old_locus_tag="AGR_pTi_49"
                     /old_locus_tag="Atu6011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_040132230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_010974824.1"
                     /translation="MSASALLDNQCDHFSTKMVDLIMVDKADELDRRVSDAFSEREAS
                     RGRRITQISGECSAGLACKRLADGRFPEISAGEKVAALSAYIYVGKEILGRILESEPW
                     ARARVSGLVAIDLAPFCMDFSEAQLLQTLFLLSGKRCASSDLSHFVAISISKTARSRT
                     LQMPPYEKGTTKRVTGFTLTLEEAVPFDMVAYGRNLMLKASAGSFPTIDLLYDYRSFF
                     DQCSDSGRIGFFPEDVPKPKVAIIGAGISGLVVASELLHAGVDDVTIYEASDRVGGKL
                     WSHAFKDAPSVVAEMGAMRFPPAASCLFFFLERYGLSSMRPFPNPGTVDTNLVYQGLR
                     YMWKAGQQPPKLFHRVYSGWRAFLKDGFHEGDIVLASPVAITQALKSGDIRRAHDSWQ
                     TWLNRFGRESFSSAIERIFLGTHPPGGETWSFPHDWDLFKLMGIGSGGFGPVFESGFI
                     EILRLVINGYEENQRMCSEGISELPRRIATQVVNGVSVSQRIRHVQVRAIEKEKTKIK
                     IRLKSGISELYDKVVVTSGLANIQLRHCLTCDTTIFRAPVNQAVDNSHMTGSSKLFLL
                     TERKFWLDHILPSCVLMDGIAKAVYCLDYEPQDPNGKGLVLISYTWEDDSHKLLAVPD
                     KKERFCLLRDAISRSFPAFAQHLVPACADYDQNVVQHDWLTDENAGGAFKLNRRGEDF
                     YSEELFFQALDMTNDTGVYLAGCSCSFTGGWVEGAIQTACNAVCAIIHNCGGILAKDN
                     PLEHSWKRYNYRNRN"
     gene            19337..20059
                     /locus_tag="ATU_RS23060"
                     /old_locus_tag="AGR_pTi_50"
                     /old_locus_tag="Atu6012"
     CDS             19337..20059
                     /locus_tag="ATU_RS23060"
                     /old_locus_tag="AGR_pTi_50"
                     /old_locus_tag="Atu6012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(dimethylallyl)adenosine tRNA
                     methylthiotransferase"
                     /protein_id="WP_010891460.1"
                     /translation="MDLRLIFGPTCTGKTSTAVALAQQTGLPVLSLDRVQCCPQLSTG
                     SGRPTVEELKGTSRLYLDDRPLVKGIIAAKQAHERLMGEVYNYEAHGGLILEGGSISL
                     LKCMAQSSYWSADFRWHIIRHELADEETFMNVAKARVKQMLRPAAGLSIIQELVDLWK
                     EPRLRPILKEIDGYRYAMLFASQNQITSDMLLQLDADMEDKLIHGIAQEYLIHARRQE
                     QKFPRVNAAAYDGFEGHPFGMY"
     gene            20575..21135
                     /locus_tag="ATU_RS23065"
                     /old_locus_tag="AGR_pTi_51"
                     /old_locus_tag="Atu6013"
     CDS             20575..21135
                     /locus_tag="ATU_RS23065"
                     /old_locus_tag="AGR_pTi_51"
                     /old_locus_tag="Atu6013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010892366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RolB family protein"
                     /protein_id="WP_010891459.1"
                     /translation="MTRQGWLVPCLSHGKDDQLQDELSELSKAYRKKFQTDLHTKSGD
                     IIDPSGEFLYVYLDEENYRICRQSMVLVSNAPDGLIATTLEPYSDSYTFRQVREQLQA
                     FSGDGGRINYSRNEHSSSYFLTIQASNEFKHVGAVRNTFGQSKDIWKRRMPDASQPLD
                     YHLIAVGCSAFLPEAALDDVESDGAV"
     gene            complement(21618..22241)
                     /locus_tag="ATU_RS23070"
                     /old_locus_tag="AGR_pTi_bx99"
                     /old_locus_tag="Atu6014"
     CDS             complement(21618..22241)
                     /locus_tag="ATU_RS23070"
                     /old_locus_tag="AGR_pTi_bx99"
                     /old_locus_tag="Atu6014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010892367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RolB family protein"
                     /protein_id="WP_010974825.1"
                     /translation="MTVANWQVRDLTLILRTGEMQSRLEQARTDFGALLPETVYFQPS
                     AIRLGEFDDEYILTRQELVYVYLREDIARQCALRRHLPSNSSNSGIMATAIPPWLMDA
                     RRLNRVMQERCDQGGLVHYYQGPHTNQFFLAIMPSNCFVRFGTDVINNENYGFYARGG
                     NYTEEGEDDDDEMDDEDETGGAETRDSQTGNLINYPIIALGSCHLSA"
     gene            complement(23231..24472)
                     /locus_tag="ATU_RS23075"
                     /old_locus_tag="AGR_pTi_53"
                     /old_locus_tag="Atu6015"
     CDS             complement(23231..24472)
                     /locus_tag="ATU_RS23075"
                     /old_locus_tag="AGR_pTi_53"
                     /old_locus_tag="Atu6015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD/NADP-dependent octopine/nopaline
                     dehydrogenase family protein"
                     /protein_id="WP_010974826.1"
                     /translation="MAITLSATSLPISAADHHPLPLTVGVLGSGHAGTALAAWFASRH
                     VPTALWAPADHPGSISAIKASEGVITTEGMINGPFRVSACDDLAAVIRSSRVLIIVTR
                     ADVHDSFVNELANFNGELATKDIVVVCGHGFSIKYERQLRFKRIFETDNSPITSKLSD
                     QKKCNVNIKEMKASFGLSCFPIHRDDAGVIDLPEDTKNIFAQLFSARIICIPPLQVLF
                     FSNYITHAVPAVMNIGRLRDPANSLTKRAEKWLLELDERTPRAEKGFFFYGEGSNTYV
                     CNVQEQIDHERRKVAAACGLRLNSLLQECNDEYDTDYETLREYCLAPSPHNVHHACPD
                     NMEHRYFSEELCSLEDVAAIAAIAKIEIPLTHAFINIIHAGKGKINPTGKSSSVIGNF
                     SSSDLIRFGATHVFNKDEMVE"
     gene            complement(24980..26044)
                     /locus_tag="ATU_RS23080"
                     /old_locus_tag="AGR_pTi_54"
                     /old_locus_tag="Atu6016"
     CDS             complement(24980..26044)
                     /locus_tag="ATU_RS23080"
                     /old_locus_tag="AGR_pTi_54"
                     /old_locus_tag="Atu6016"
                     /function="involved in nopaline catabolism (ornithine
                     cyclodeaminase)"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase"
                     /protein_id="WP_010891456.1"
                     /translation="MPALANLNIVPFISVENMMDLAVSTGIENFLVQLAGYIEEDFRR
                     WESFDKIPRIASHSRDGVIELMPTSDGTLYGFKYVNGHPKNTKSGRQTVTAFGVLSDV
                     DSGYPLLLSEMTILTALRTAATSAIAAKYLARKDSRTMALIGNGAQSEFQALAFKALI
                     GVDRIRLYDIDPEATARCSRNLQRFGFQIEACTSAEQAVEGADIITTATADKHNATIL
                     SDNMIGPGVHINGVGGDCPGKTEMHRDILLRSDIFVEFPPQTRIEGEIQQLAPDHPVT
                     ELWRVMTGQDVGRKSDKQITLFDSVGFAIEDFSALRYVRDRVEGSSHSSPLDLLADPD
                     EPRDLFGMLLRRQAFRRLGG"
     gene            complement(26092..27174)
                     /locus_tag="ATU_RS23085"
                     /old_locus_tag="AGR_pTi_55"
                     /old_locus_tag="Atu6017"
     CDS             complement(26092..27174)
                     /locus_tag="ATU_RS23085"
                     /old_locus_tag="AGR_pTi_55"
                     /old_locus_tag="Atu6017"
                     /function="involved in nopaline catabolism"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD/NADP octopine/nopaline dehydrogenase family
                     protein"
                     /protein_id="WP_010891455.1"
                     /translation="MKVGIAGAGSIAIGYAAFLLQNGHEPLIWSRSRERTAAFSAGAP
                     VKITGAISTEFHPHICTNAEELTEADVIVLALPAYGHRFVLDALLPHLSARHSVIISA
                     HLSFAALYLAKGLAERGIEIPITAWSTTVLTCKPRAADTFNIGAIRAKVDMATVPARF
                     AERAHETCVALFGDRFDVKDDVLTIALSNLNPQDHMGIALCNLSRIERAEEWGQNTNV
                     TPAVGRFLEALDLERLAIASAFGKTVRSTFDHFRLSFDISGQSVSEISSILVDRGSDP
                     AGPKSLDTRYVLEDVPFGLIPTLHLAKAAGLSAPLHESGVRILSACYGRDFSEENDLL
                     PDLGPLDLPTLKKRVVTGYAITAEPV"
     gene            complement(27251..28174)
                     /gene="rocF"
                     /locus_tag="ATU_RS23090"
                     /old_locus_tag="AGR_pTi_56"
                     /old_locus_tag="Atu6018"
     CDS             complement(27251..28174)
                     /gene="rocF"
                     /locus_tag="ATU_RS23090"
                     /old_locus_tag="AGR_pTi_56"
                     /old_locus_tag="Atu6018"
                     /EC_number="3.5.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010668063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginase"
                     /protein_id="WP_045023491.1"
                     /translation="MKTCQILGAPVQSGASQPGCLMGPDAFRTAGLTQVLTELGWAVT
                     DLGDATPTVEPELSHPNSAVKNLDALVGWTRSLSQKALEMARSCDLPVFLGGDHSMSA
                     GTVSGVAQRTAELGKEQFVLWLDAHTDLHTLHTTASGNLHGTPVAYYTGQSGFEGLPP
                     LAAPVNPRNVSMMGIRSVDPEERRRVAEIGVQVADMRVLDEQGVVRPLEAFLDRVSKV
                     SGRLHVSLDVDFLDPAIAPAVGTTVPGGATFREAHLIMEMLHDSGLVTSLDLAELNPF
                     LDERGRTARLITDLASSLFGRRVFDRVTTAF"
     gene            complement(28273..29691)
                     /locus_tag="ATU_RS23095"
                     /old_locus_tag="AGR_pTi_58"
                     /old_locus_tag="Atu6019"
     CDS             complement(28273..29691)
                     /locus_tag="ATU_RS23095"
                     /old_locus_tag="AGR_pTi_58"
                     /old_locus_tag="Atu6019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_010974827.1"
                     /translation="MNHHSSADLLIVGAGPAGMAAARRAVRGGLSVIVLDSQSQPGGQ
                     IWRNAGRNATSPIINILGAEYRRGVRQVEAFLACGADYIPDAQVSRLSQGWTVEYVWG
                     GEIRSVRGRHLLLATGAQERPVPFTGWTLPGVMTVGAAQILLKTAGQLPRGPVAVVGS
                     GPLPLLYMQQMRLAGAKPVAHLDTTPRGLISRSLRGFRGALQEPGQILKGIAWLPQFS
                     GVRHVRNVVKISAKGSGRLETVRFETSSGRSDRLEVKSLLVHEGLVPSHQLAVSAGAQ
                     LMWDVGQSAFRLERDEWMNAGPDGLYIAGDGARIGGAVNAEIEGEIAAIGVLLRDGAL
                     TAAQADTETKPLRAQHGRQKSFRRFLDGAYPPNIARTPPDDATIVCRCEELSAGVLRE
                     AAVRGACRGPNQLKSFTRAGMGPCQGRQCGYPVHELVKSVAGLTAGEVGLFNPRPPFV
                     PLTVSMLAAQQAEEVVSASTHE"
     gene            complement(29688..29981)
                     /locus_tag="ATU_RS23100"
                     /old_locus_tag="AGR_pTi_bx141"
                     /old_locus_tag="Atu6020"
     CDS             complement(29688..29981)
                     /locus_tag="ATU_RS23100"
                     /old_locus_tag="AGR_pTi_bx141"
                     /old_locus_tag="Atu6020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_003523884.1"
                     /translation="MTSEILFPSGQAVEITVDGRLVTARDGEPLAAVFLRLDDIHTRT
                     SFPSAQPRAPYCMMGVCFECVVHVEDIGTIRSCQQTVHAGMRVERHDHPKRLK"
     gene            complement(29978..31096)
                     /locus_tag="ATU_RS23105"
                     /old_locus_tag="AGR_pTi_61"
                     /old_locus_tag="Atu6021"
     CDS             complement(29978..31096)
                     /locus_tag="ATU_RS23105"
                     /old_locus_tag="AGR_pTi_61"
                     /old_locus_tag="Atu6021"
                     /function="involved in nopaline catabolism (nopaline
                     dehydrogenase)"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="WP_010891452.1"
                     /translation="MDHEFETAIVGGGVVGAAIGYGLAKLGRRVIIIDGADDALRASR
                     TNFGLIWVQGKGDEYPAYHRITRQSAELWPGFASELKELTGVDVEYRRNGGLLFCASE
                     AQAEEEKAIGEKMAAIHPDYRFEMLERSRIERMLPDIRLGPKVCSASFSHMDGDVNPL
                     LVLRAMLDGFVRLGGTLMTGEHVDSIAPTLGGFRLATDGLTIEAERVIIAAGNDSMAF
                     AKSLDLPLLLVPEKGQLLITERVAPVFPYAASGIRQTMTGTFQLGVTNERVGRSTDVT
                     AAGARHIANRAINVMPDVGALRVIRQWAGLRVLTPDGVPVYDRSRRYPGIHVVACHSG
                     VTLAALHAGPFAEWLAAGGREPSYDAFRGSRFKMGIAA"
     gene            31704..33740
                     /locus_tag="ATU_RS23110"
                     /old_locus_tag="AGR_pTi_62"
                     /old_locus_tag="Atu6022"
     CDS             31704..33740
                     /locus_tag="ATU_RS23110"
                     /old_locus_tag="AGR_pTi_62"
                     /old_locus_tag="Atu6022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydantoinase/oxoprolinase family protein"
                     /protein_id="WP_010974828.1"
                     /translation="MLRIGVDIGGTFTDFCGWREGEDRIVTLKVPSTPPAFENGFREG
                     FEKLLERLAPEPGEAAFLMHGTTVSTNAVIERKGPKIAFFVTKGYRDLLELQRIGVRN
                     PLNLFETRTRPLIDREMVFEVEERLLRGGLVRTSIDEAAVEALARRAADAGAAGYAVA
                     LLHSYANPQHEQAVARAIRKAVGEDAEVSLSSEIWPRIGEYERAIVSVLNAFVKRRMN
                     EYIGAVETYVAERLPGSQLFVTRSNGGAMAASEARNFPVHTLLSGPASGVTAVQYLGR
                     ALGEHNILTMDMGGTSTDISLVRDGEALTSTSAEVGEFPVVMPVTSIEAIGAGGGSVV
                     TIDGGVLRIGPRSAGSYPGPACFSRGGTEPTLTDAFLLAGYLPEALLGGDMQLDRHAA
                     ERAMAPIAETLKTDVLSAAEMCVTVASSNMVAGVLPYLARQGVDPEDLTVLVYGGAGA
                     IQGPLLAAEIGVNRVLVPATPSVFCALGGLVSDLSNDALETVHGLDIDGSLIAKKFQV
                     LREQGAEWLSRQAPPERLVSKTFECWAEMRYVGQSFQVDVRLPDTAIEAHDIAAMHAA
                     FHQEHERIYSHADKAAPVEFVDLRMRVRGSMSIPQPSTPETSGAGGALKTVRSMRFHN
                     KLIPEVRVFDRASLTPNDAIQGPAVIEQRDATIVVPPEFVARVGAFGAILMTRS"
     gene            33744..35699
                     /locus_tag="ATU_RS23115"
                     /old_locus_tag="AGR_pTi_63"
                     /old_locus_tag="Atu6023"
     CDS             33744..35699
                     /locus_tag="ATU_RS23115"
                     /old_locus_tag="AGR_pTi_63"
                     /old_locus_tag="Atu6023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydantoinase B/oxoprolinase family protein"
                     /protein_id="WP_003523890.1"
                     /translation="MDAVRTAVMNNRFNAIVEEASAAIYRTAHTTFVKIVQDYQCAIA
                     TAEGEMFAYPMLSGVNVFVGSPLKPTLDAIGRENLKPGDIIITNDPFATDGLVTHLMD
                     VTLLYPIFFDEKLIAIGWAFVHASDIGGAVPGSISPAFTEVFQEGLRVRPMKLYEGGV
                     LNEAIKSIFQDNSRIPTELWGDIQAMISGLKSMDRRVSELCERYDRESVEEGMQDVIN
                     YAETKARAVIRTIRDGVYTFSDYLEGIHDGQLAYFSVTMTVKDSEIEVDFTGTDPQLA
                     AAYNLVTGATTHPYIIQCLYAYILTVDPLTPRNSGILRAIHGHAPRGTVLNAVYPASG
                     GSRAASATRAYDVILGCLNQALPEGLAAAGGGMSGVIVVSAPDPRTGRDRVNVVGTID
                     GGGGARRGVDGLDGSEVRYSQRSVPVEVIEIETVLVMRALRLVPDSRRAGRFASGAAL
                     EIEMENTSNRAVITVRNLNRFVFAPWGFKGGEIGLLGKAVVNPGRPDERSVGKISVLE
                     LGQGDILRITSSTGGAFGEPLERDVAAIAREIENGMLSPERAADVYAVVFDRDSKIDE
                     AATAEHRRERANRKSDDFNFCIVRQRQDQVWSQQTRRELASRALTYEQRIRSQLVDRV
                     HHRLLAKGERVDAGKLDQVIAEEAGRL"
     gene            complement(35819..36739)
                     /locus_tag="ATU_RS23120"
                     /old_locus_tag="AGR_pTi_64"
                     /old_locus_tag="Atu6024"
     CDS             complement(35819..36739)
                     /locus_tag="ATU_RS23120"
                     /old_locus_tag="AGR_pTi_64"
                     /old_locus_tag="Atu6024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974829.1"
                     /translation="MSYQIEIGSIRCFVVAAEELHFRRAAIRLNMSQPTLSQQIKRLE
                     ELMGVQLFIRSTRRVDLTRAGASFLDHARDILLKIDEAILNAKLEAGGLSPGGEELII
                     GAISPATSQLLPLILSRFRQRFPRTRLAIKEVDSIELLRGIERGDFHVGLMRPPSNSN
                     LVRFRHLLSERFVAVMPRQSALARKPALRLSDFAGHGVFALKRFELSCFETVYEQLSG
                     AGLLIENDIAVSDTNTALALVTAGAGITFLPEWVSAMAPDGVVTRVVDDMSVEISMAV
                     GWNPDCPVPGILPFVEFATLAAQNLISARK"
     gene            complement(36854..37579)
                     /gene="nocM"
                     /locus_tag="ATU_RS23125"
                     /old_locus_tag="AGR_pTi_65"
                     /old_locus_tag="Atu6025"
     CDS             complement(36854..37579)
                     /gene="nocM"
                     /locus_tag="ATU_RS23125"
                     /old_locus_tag="AGR_pTi_65"
                     /old_locus_tag="Atu6025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nopaline ABC transporter permease NocQ"
                     /protein_id="WP_003523894.1"
                     /translation="MDIQLIIESFPKLLAAVPTTLTLAFISLLIGFVVSVPVALMRLS
                     KNRIVSSLAYGYVYIIRSTPLLVQMFLIYYGSAQFRGVLSEVGLWSSFREPWFCAILA
                     LALNTAAYTSEIIRGGIQSVSLGQIEAARAVGMSTFLQFRRIVFPIAIRQALPAYGNE
                     VMLIIKSTSLASTITIVEVTGLAKQIISATYSPVEVFIVAGAIYLFITFVVSRLVMLA
                     EWWLNPHMRARVGGTAPKAAETH"
     gene            complement(37581..38291)
                     /gene="nocQ"
                     /locus_tag="ATU_RS23130"
                     /old_locus_tag="AGR_pTi_66"
                     /old_locus_tag="Atu6026"
     CDS             complement(37581..38291)
                     /gene="nocQ"
                     /locus_tag="ATU_RS23130"
                     /old_locus_tag="AGR_pTi_66"
                     /old_locus_tag="Atu6026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nopaline ABC transporter permease NocM"
                     /protein_id="WP_010891638.1"
                     /translation="MDLTLLQWGDAGWGDELARGAMMTVVVAACSYFFGIIFGSLFAA
                     AKLSRFWSLRLLGDVYTTVVRGVPELLIIFLVFFGGGTLLRTIANGLFGYEGYIEPPI
                     FVIGVLCISVSAGAYATEVIRAAVLAVPPGQIEAAKSIGMGPWLRLRRVLIPQAARFA
                     LPGLGNVWQFTLKDTSLISVVGLVEIMRTAAMGAGSTKQPFTFYITAFVIFLLLSSVS
                     NRGFLKAEKWANRGVRSQ"
     gene            complement(38365..39216)
                     /gene="nocT"
                     /locus_tag="ATU_RS23135"
                     /old_locus_tag="AGR_pTi_67"
                     /old_locus_tag="Atu6027"
     CDS             complement(38365..39216)
                     /gene="nocT"
                     /locus_tag="ATU_RS23135"
                     /old_locus_tag="AGR_pTi_67"
                     /old_locus_tag="Atu6027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nopaline ABC transporter substrate-binding
                     protein NocT"
                     /protein_id="WP_010891637.1"
                     /translation="MKFFNLNALAAVVTGVLLAAGPTQAKDYKSITIATEGSYAPYNF
                     KDAGGKLIGFDIDLGNDLCKRMNIECKFVEQAWDGIIPSLTAGRYDAIMAAMGIQPAR
                     EKVIAFSRPYLLTPMTFLTTADSPLLKTQVAIENLPLDNITPEQKAELDKFTKIFEGV
                     KFGVQAGTSHEAFMKQMMPSVQISTYDTIDNVVMDLKAGRIDASLASVSFLKPLTDKP
                     DNKDLKMFGPRMTGGLFGKGVGVGIRKEDADLKALFDKAIDAAIADGTVQKLSQQWFG
                     YDASPKQ"
     gene            complement(39281..40054)
                     /gene="nocP"
                     /locus_tag="ATU_RS23140"
                     /old_locus_tag="AGR_pTi_69"
                     /old_locus_tag="Atu6028"
     CDS             complement(39281..40054)
                     /gene="nocP"
                     /locus_tag="ATU_RS23140"
                     /old_locus_tag="AGR_pTi_69"
                     /old_locus_tag="Atu6028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nopaline ABC transporter ATP-binding protein
                     NocP"
                     /protein_id="WP_010974830.1"
                     /translation="MDATQPTLVAEDVHKNFGTLEILKGISLTANKGDVVSIIGSSGS
                     GKSTFLRCMNFLETPNKGRIAVGQEEVVVKTDAAGRLIGVDRKKIERMRMQLGMVFQS
                     FNLWGHMTVLQNVMEGPLHVLKQPKGEVRDRAMDFLDKVGIANKHAAYPSQLSGGQQQ
                     RVSIARALAMQPSALLFDEPTSALDPELVGEVLKVIRKLAEEGRTMVVVTHEMGFARD
                     VSSKVLFLEKGQIEEQGTPQEVFQNPTSPRCRAFLSSVL"
     gene            40308..41210
                     /locus_tag="ATU_RS23145"
                     /old_locus_tag="AGR_pTi_70"
                     /old_locus_tag="Atu6029"
     CDS             40308..41210
                     /locus_tag="ATU_RS23145"
                     /old_locus_tag="AGR_pTi_70"
                     /old_locus_tag="Atu6029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_065702830.1"
                     /translation="MIQSRQLEAFRAVMLTGGMTSAANLVRITQPAISRLIRDLEEEI
                     GISLFERTGNRLRPTREAGILFKEVSRHFNGIQHIDKVAAELKKSHMGSLRVACYTAP
                     ALSFMSGVIQTFIADRPDVSVYLDTVPSQTVLELVSLQHYDLGISILAGDYPGLTTEP
                     VPSFRAVCLLPPGHRLEDKETVHATDLEGESLICLSPVSLLRMQTDAALDSCGVHCNR
                     RIESSLALNLCDLVSRGMGVGIVDPFTADYYSANPVIQRSFDPVVPYHFAIVLPTDSP
                     PPRLVSEFRAALLDALKALPYETI"
     gene            complement(41214..41573)
                     /locus_tag="ATU_RS23150"
                     /old_locus_tag="AGR_pTi_bx125"
                     /old_locus_tag="Atu6030"
     CDS             complement(41214..41573)
                     /locus_tag="ATU_RS23150"
                     /old_locus_tag="AGR_pTi_bx125"
                     /old_locus_tag="Atu6030"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974831.1"
                     /translation="MRHVPRPNMSAVFGQNNTVSKVPNRSNYSVPGITVFGGIFLSAV
                     ATESSSSRDFDELRAGPAAYRIPSKYRADGDTSNDVFVQVNLADWGPLERDKPGSPAF
                     RPRHRAEPDIFDNLLRS"
     gene            complement(41570..42886)
                     /gene="trbI"
                     /locus_tag="ATU_RS23155"
                     /old_locus_tag="AGR_pTi_71"
                     /old_locus_tag="Atu6031"
     CDS             complement(41570..42886)
                     /gene="trbI"
                     /locus_tag="ATU_RS23155"
                     /old_locus_tag="AGR_pTi_71"
                     /old_locus_tag="Atu6031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IncP-type conjugal transfer protein TrbI"
                     /protein_id="WP_010974832.1"
                     /translation="MVQSLKLGGTAQEEEAVSGMRRINRLPIIIVVVLVVAFLGVIFY
                     GLTSRGLYFRGDEGPDTSSGNPASTFADQIKRGVSDGIIGEPQQVTTLQPTPVETQGE
                     KRAVNPFTPQPGQREEARPEAQLESEQVWRARLQREQEEQYLRERQRQRMARLQANDA
                     AYDSPIAVDRGKFNEREANTNDTAAATTSGASTAMTPGASDLYAAALRAGLGGQNGDP
                     NGQKSKEDFFNADLKELGYLPNRVVPQQSLYELKRGSVIPATLITGINSDLPGRITAQ
                     VSQNVYDSATGHLLLIPQGTKLFGRYDSKVSFGQSRVLVVWTDIIFPNGSTLQIGGMA
                     GTDAQGYSGSRDKVDRNWLQTFGSAILIAVIGTGIDMAVPESSTLATQDTASDAARRN
                     FAETFGRVADRTIQRNMDVQPTLEIRPGYKFNVLVDQDIVFPGAYR"
     gene            complement(42899..43375)
                     /locus_tag="ATU_RS23160"
                     /old_locus_tag="AGR_pTi_72"
                     /old_locus_tag="Atu6032"
     CDS             complement(42899..43375)
                     /locus_tag="ATU_RS23160"
                     /old_locus_tag="AGR_pTi_72"
                     /old_locus_tag="Atu6032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018325663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbH"
                     /protein_id="WP_010974833.1"
                     /translation="MRSLLSHPQPSHAIRSPAAACALALFLSGCQSLGTDGLTASNAP
                     AEISGPAASAIAGDMVGRLAEQIGPGTATVSLKQDNSPFGQALEAALKGWGYAVVTDQ
                     KTDGVSRIVPLAYVVIPFEGQVLTRLSTNSIELGRAYIVTTSGAQPASALAVMKRG"
     gene            complement(43375..44229)
                     /gene="trbG"
                     /locus_tag="ATU_RS23165"
                     /old_locus_tag="AGR_pTi_73"
                     /old_locus_tag="Atu6033"
     CDS             complement(43375..44229)
                     /gene="trbG"
                     /locus_tag="ATU_RS23165"
                     /old_locus_tag="AGR_pTi_73"
                     /old_locus_tag="Atu6033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003510267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type conjugative transfer protein TrbG"
                     /protein_id="WP_010974834.1"
                     /translation="MNIQLRRFSATLTAATIVAVIVPFSASLSSRALAADGVTANEAK
                     GMGISGQWRGSRGLVTKGPDGKVIFLYGEVQPSVVCSPLQVCDIELQGGEVVRDVLVG
                     DTVRWKVEPATSGAAGGQAIHLIVKPSEPNLVTSMVVTTSRRTYHIQLKSHANQYMAR
                     VGFEYPEDVSARLADINARMEANTIPGAGVPAEQLSFSYSVSGSAGWRPTRLYSDGEK
                     TYIQFPRSISGQDAPVLFVVSGGQNRIVNYRMKGDMMIVDYNVDRAVLVSGVGWKQEK
                     VTIRRGGR"
     gene            complement(44247..44909)
                     /locus_tag="ATU_RS23170"
                     /old_locus_tag="AGR_pTi_74"
                     /old_locus_tag="Atu6034"
     CDS             complement(44247..44909)
                     /locus_tag="ATU_RS23170"
                     /old_locus_tag="AGR_pTi_74"
                     /old_locus_tag="Atu6034"
                     /function="involved in conjugation"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007536758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbF"
                     /protein_id="WP_010891631.1"
                     /translation="MAGRTPPDNPYIAARTEWNERYGSYVKAAAAWRLVGVTGMIMAV
                     IGFSYALYQSTQVKLVPYIVEVDKLGTASNAGFPQQIEYADPRVVRATLGSFVSNFRS
                     VTPDAVVQKQYIDRTYALLRTSDPATEKVNAWFRSSSPFEKAKNATVAVEVNNIVALS
                     NQSYQIDWTEFERDRRGKETATRRFRSIATVTLTPPQDEGVIRLNPIGLYLRDLDWTA
                     QL"
     gene            complement(44924..46120)
                     /gene="trbL"
                     /locus_tag="ATU_RS23175"
                     /old_locus_tag="AGR_pTi_76"
                     /old_locus_tag="Atu6035"
     CDS             complement(44924..46120)
                     /gene="trbL"
                     /locus_tag="ATU_RS23175"
                     /old_locus_tag="AGR_pTi_76"
                     /old_locus_tag="Atu6035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006312337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type conjugative transfer protein TrbL"
                     /protein_id="WP_010974835.1"
                     /translation="MVVVRPSRRLEMTFIVMAIVLLATAPAFAQQGTVLTTLENQVVT
                     AAKGWETTILNAARSLFWILAGIEIGIAAVWLAINAASLDAWFAELVRRIMFIGLFAF
                     ILERGPALAKAVVDSLFQIGAGGGSASPANIFDAGIRVASKMSEQAKFGLFEDNALAI
                     AAVFAMVVVVVSFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFAVRYLVYAF
                     SVGMKLMALVMIAKIGSDILIGLAEAPTATSDQFITTLAIAGISVVVFVIAMYVPPII
                     QGVVQGASVSGGMEAIRHGGQTAAFAAGGAFLGAGAAMKGAQSASTARAEGSSMAGAA
                     LRGMASGIGNAGWAAGSAAKEKAIASPGAYAGSLLGLANAKLDQTRQSGRPSAPPPPP
                     PVNENK"
     gene            complement(46114..46332)
                     /gene="trbK"
                     /locus_tag="ATU_RS23180"
                     /old_locus_tag="AGR_pTi_78"
                     /old_locus_tag="Atu6036"
     CDS             complement(46114..46332)
                     /gene="trbK"
                     /locus_tag="ATU_RS23180"
                     /old_locus_tag="AGR_pTi_78"
                     /old_locus_tag="Atu6036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012649097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="entry exclusion protein TrbK"
                     /protein_id="WP_010974836.1"
                     /translation="MSPRILIALAVAGLVAIAGGTILWVVVQPDAAIETPTGTSGSGE
                     ARREQRERFFGGDPDRDVRGGQEMKPRW"
     gene            complement(46329..47132)
                     /gene="trbJ"
                     /locus_tag="ATU_RS23185"
                     /old_locus_tag="AGR_pTi_81"
                     /old_locus_tag="Atu6037"
     CDS             complement(46329..47132)
                     /gene="trbJ"
                     /locus_tag="ATU_RS23185"
                     /old_locus_tag="AGR_pTi_81"
                     /old_locus_tag="Atu6037"
                     /function="involved in conjugation"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010892444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type conjugative transfer protein TrbJ"
                     /protein_id="WP_010891628.1"
                     /translation="MPRHFSRPLEAARVAMITAIVILVAFPTYAGGVTGQATEWTQLA
                     NNAELISLVGKSAEQVNNQITQISQLAEQIQNQINIYKNLLQNTAQLPNHIWGQVEND
                     LSKLQNIVAQGQGVAFSMGNIDDVLKQRFQSFADMKTNLPDGQSFSSTYQGWSDTNRD
                     TIAGTLKAANLTAEQFSSEESTMSSLRSLSESADGQMKALQVGHQIATQQVAQMQKLR
                     GLVSQQMTMMGTWFQSEQAQKDLAQARREQFFNAPTNDIRGGQTMEPRW"
     gene            complement(47104..49572)
                     /locus_tag="ATU_RS23190"
                     /old_locus_tag="AGR_pTi_83"
                     /old_locus_tag="Atu6038"
     CDS             complement(47104..49572)
                     /locus_tag="ATU_RS23190"
                     /old_locus_tag="AGR_pTi_83"
                     /old_locus_tag="Atu6038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VirB4 family type IV secretion/conjugal transfer
                     ATPase"
                     /protein_id="WP_010974837.1"
                     /translation="MVALKQFRHSGPSFADLVPYAGLVDNGVILLKDGSLMAGWYFAG
                     PDSESSTDAERNEVSRQINMILSRLGSGWMIQVEALRVPTIDYPAEDACHFPDPVTRA
                     IDAERRSHFERESGHFESRHALILTWRPPEPRRSGLTRYVYADAGSRSATYADTALDS
                     FRTSIREVEQYLANVVSIRRMMTQETQERGGFRRARYDELFQFIRFCITGENHPIRLP
                     DIPMYLDWLVTAELQHGLTPTIENRFLGVVAIDGLPAESWPGILNSLDLMPLTYRWSS
                     RFVFLDEQEARSRLERTRKKWQQKVRPFFDQLFQTQSRSVDQDAMMMVAETEDAIAQA
                     ASQLVAYGYYTPAIILFDEVQPRLQEKCEAIRRLIQAEGFGARIETLNATDAFLGSLP
                     GVSYANIREPLVNTRNLADLIPLNSVWSGNPVAPCPFYPAGSPPLMQVASGSTPFRLS
                     LHVDDVGHTLVFGPTGSGKSTLLALIAAQFRRYAGAQIFAFDKGRSMLPLTLAIGGDH
                     YEIDGDAAGEGEGASPRLAFCPLAELSTDGDRAWAAEWIETLVALQGVTVTPDYRNAI
                     SRQLVLMAESRGRSLSDFVSGVQMREIKDALHHYTVDGPMGQLLDAEEDGLALGAFQC
                     FEVEELMNMGERNLVPVLLYMFRRVEKRLTGAPSLIIIDEAWLMLGHPTFRDKIREWL
                     KVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKICLPNGAAREPGTREFYERIGF
                     NERQIEIVATAMPKREYYVASPEGRRLFDMSLGPVALSFVGASGKEDLKSIRALHSEN
                     GADWPIHWLQQRGIAHAETLFPAA"
     gene            complement(49583..49882)
                     /locus_tag="ATU_RS23195"
                     /old_locus_tag="AGR_pTi_85"
                     /old_locus_tag="Atu6039"
     CDS             complement(49583..49882)
                     /locus_tag="ATU_RS23195"
                     /old_locus_tag="AGR_pTi_85"
                     /old_locus_tag="Atu6039"
                     /function="involved in conjugation"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018240855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VirB3 family type IV secretion system protein"
                     /protein_id="WP_010891626.1"
                     /translation="MAEPGSNLARSRVHRALSRPNLLMGADRELVLLTGLAAVILIFV
                     VLTWYAALFGVAIWLVAVAALRMMAKSDPLMRRVYLRHVSYRSHYRPTSTPWRKF"
     gene            complement(49875..50276)
                     /locus_tag="ATU_RS23200"
                     /old_locus_tag="AGR_pTi_87"
                     /old_locus_tag="Atu6040"
     CDS             complement(49875..50276)
                     /locus_tag="ATU_RS23200"
                     /old_locus_tag="AGR_pTi_87"
                     /old_locus_tag="Atu6040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012650640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilin TrbC"
                     /protein_id="WP_010974812.1"
                     /translation="MSHKIRIAIALAAFAAGSFIGLADPAFASSGGSLPWESPLQQIQ
                     QSITGPVAGFIALAAVAIAGGMLIFGGELNDFARRLCYVALVGGVLLGATQIIALFGA
                     TGASIGEMEARTGPGIIEPVMLRAQGEGAHG"
     gene            complement(50266..51237)
                     /gene="trbB"
                     /locus_tag="ATU_RS23205"
                     /old_locus_tag="AGR_pTi_89"
                     /old_locus_tag="Atu6041"
     CDS             complement(50266..51237)
                     /gene="trbB"
                     /locus_tag="ATU_RS23205"
                     /old_locus_tag="AGR_pTi_89"
                     /old_locus_tag="Atu6041"
                     /function="involved in conjugation"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012649102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type conjugative transfer ATPase TrbB"
                     /protein_id="WP_010891624.1"
                     /translation="MTQLRSHSRLVRKLQDALGDQLCVALDDATVVEIMLNPDGKLFI
                     ERLGHGVAPAGLLSPAAAEVIIGSVAHALQSEADDEQPIISGELPIGGHRFEGLLPPV
                     VSGPSFTIRRRASRLIPLDDYVKHKIMTAAQVSVLRSAIASRMNIVISGGTGSGKTTL
                     ANAVIAEIVANAPDDRIVILEDTAEIQCAAENAVALHTSDTIDMARLLKSTMRLRPDR
                     IIVGEVRDGAALTLLKAWNTGHPGGVTTIHSNTAMSALRRLEQLTAEVSQQPMQEVIG
                     EAVDLIVSIERTGKGRRVREVIHVEGFANARYRTEHYAQIDEDSHVA"
     gene            complement(51234..51869)
                     /gene="traI"
                     /locus_tag="ATU_RS23210"
                     /old_locus_tag="AGR_pTi_91"
                     /old_locus_tag="Atu6042"
     CDS             complement(51234..51869)
                     /gene="traI"
                     /locus_tag="ATU_RS23210"
                     /old_locus_tag="AGR_pTi_91"
                     /old_locus_tag="Atu6042"
                     /EC_number="2.3.1.184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-homoserine-lactone synthase"
                     /protein_id="WP_010974838.1"
                     /translation="MRILTVSPDQYERYRSFLKQMHRLRATVFGGRLEWDVSIIAGEE
                     RDQYDNFKPSYLLAITDSGRVAGCVRLLPACGPTMLEQTFSQLLEMGSLAAHSGMVES
                     SRFCVDTSLVSRRDASQLHLATLTLFAGIIEWSMASGYTEIVTATDLRFERILKRAGW
                     PMRRLGEPTAIGNTIAIAGRLPADRASFEQVCPPGYYSIPRIDVAAIRSAA"
     gene            52233..53450
                     /gene="repA"
                     /locus_tag="ATU_RS23215"
                     /old_locus_tag="AGR_pTi_93"
                     /old_locus_tag="Atu6043"
     CDS             52233..53450
                     /gene="repA"
                     /locus_tag="ATU_RS23215"
                     /old_locus_tag="AGR_pTi_93"
                     /old_locus_tag="Atu6043"
                     /function="involved in vegetative DNA replication"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008120558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein RepA"
                     /protein_id="WP_010891622.1"
                     /translation="MSKAAAISRNDRPSVDVTIGEHAEQLSSQLQAMSEALFPPTSHK
                     SLRKFTSGEAARLMKISDSTLRKMTLAGEGPQPELASNGRRFYTLGQINEIRQMLAGS
                     TRGRESIDFVPHRRGSEHLQVVAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDP
                     QASLSALLGVLPETDVGANETLYAAIRYDDTRRPLRDVIRPTYFDGLHLVPGNLELME
                     FEHTTPKALTDKGTRDGLFFTRVAQAFDEVADDYDVVVIDCPPQLGFLTLSGLCAATS
                     MVITVHPQMLDIASMSQFLLMTRDLLGVVKEAGGNLQYDFIRYLLTRYEPQDAPQTKV
                     TALLRNMFEDHVLTNPMVKSAAVSDAGLTKQTLYEIGRENLTRSTYDRAMESLDAVNS
                     EIEALIKMAWGRV"
     gene            53680..54690
                     /gene="repB"
                     /locus_tag="ATU_RS23220"
                     /old_locus_tag="AGR_pTi_94"
                     /old_locus_tag="Atu6044"
     CDS             53680..54690
                     /gene="repB"
                     /locus_tag="ATU_RS23220"
                     /old_locus_tag="AGR_pTi_94"
                     /old_locus_tag="Atu6044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013650747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein RepB"
                     /protein_id="WP_032489589.1"
                     /translation="MSRKDAIDTLFLKKQPATDRAAVDKSTARVRTGAISAMGSSLQE
                     MAEGAKAAARLQDQLATGEAVVSLDPSMIDGSPIADRLPSDVDPKFEQLEASISQEGQ
                     QVPVLVRPHPEAAGRYQIVYGRRRLRAAVNLRREVSAIVRNLTDCELVVAQGRENLNR
                     ADLSFIEKALFALRLEDAGFDRATIIAALSTDKADLSRYITVARGIPLNLATQIGPAS
                     KAGRSRWVVLAEGLGKPKATDAIEAMLGSEQFKQSDSDTRFNLIFNAVSRPPAKTPKK
                     VRAWSTPKGKKAATIRQETGRTALVFDERLVPTFGEYVADQLDSLYAQFIETNGGGKL
                     DQ"
     gene            54905..56224
                     /locus_tag="ATU_RS23225"
                     /old_locus_tag="AGR_pTi_95"
                     /old_locus_tag="Atu6045"
     CDS             54905..56224
                     /locus_tag="ATU_RS23225"
                     /old_locus_tag="AGR_pTi_95"
                     /old_locus_tag="Atu6045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepC"
                     /protein_id="WP_010974840.1"
                     /translation="MQTHISTTSFGRRPMTLGHIASQMAAKAVASDTVAHKWQVFQHI
                     RESRGLIGATDRSLSILNALLTFYPETALTGGAELVVWPSNEQLMARANGMPATTLRR
                     HLAILVDCGLIIRRDSPNGKRFARKGRGGEIEQAYGFDLSPIVARAEEFRDLAQTVQA
                     EKKAFRVAKERLTLLRRDIVKMIETGVEESVPGNWGRVTQTYQGIIGRLPRSAPRQLV
                     ESIGQELQELCIEIRDVLESFTKTMNLDANESHIGRHKQNSNPDSKFESEYSSGKKDE
                     AGGSVAETDNVRSLPKRELPLGIVLDACPEMRELAQGGPIRHWRDLLAAAELARPMLG
                     ISPSAWREARETMGDQHAAITLASIYQRAGQINNAGGYLRSLTDRAKDGKFSTWPMVM
                     ALLRAKLDEQKNAVGAGKPRTAEEVEDDSRLHVSESLLKNLRKPRSW"
     gene            complement(56233..57174)
                     /locus_tag="ATU_RS23230"
                     /old_locus_tag="AGR_pTi_97"
                     /old_locus_tag="Atu6046"
     CDS             complement(56233..57174)
                     /locus_tag="ATU_RS23230"
                     /old_locus_tag="AGR_pTi_97"
                     /old_locus_tag="Atu6046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012650476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_046033744.1"
                     /translation="MARNTQNQRSGRPQGRIIGYARVSTDEQATDAQEIELRSAGCDI
                     IVQEHGSGAARARPALSKLLREISAGDTLVVVRLDRLARSVSHLLEVIEDMTAKGAHF
                     RSLRDPIDTSTPQGMFSLQVLGAVAQLERALISERTKAGIRAAKSKGKLSGNPGIREK
                     RPEALARMTAAQKAAYGDRIQASANQWLPTVRRMRPDHTWDDIARMLKQRGLDWTPER
                     LRRAVKWMVTERLVDAALLKKSPPRLPEDRLMTLVAGIHSSNPDLKLREIAGQLERLH
                     ERTPRGGSKWAPSSVKNLIDRARRSGLITDVDIAAAE"
     gene            57457..58566
                     /locus_tag="ATU_RS23235"
                     /old_locus_tag="AGR_pTi_98"
                     /old_locus_tag="Atu6047"
     CDS             57457..58566
                     /locus_tag="ATU_RS23235"
                     /old_locus_tag="AGR_pTi_98"
                     /old_locus_tag="Atu6047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1612 and helix-turn-helix domain-containing
                     protein"
                     /protein_id="WP_010974841.1"
                     /translation="MRYEIGDLPLTVLLPAIARAEDQIARLDEIVRRSPVRQGFTERS
                     HFTEAAASMWIAGELVHIEDLVLHDANRDVRTPTHEITIAHSILRARRRIEKADPDWA
                     TSRAGIVNLVGRSEGSAERESVGKGRSPLPAELTLNEEDNCFAAEMAEIDAVLDRSTR
                     ALEAVVTVEGSKADPLMVGELVVRDPGWDEEGRLSAWRAVLAQADALPTTLAAAVIWD
                     AWESMEPLQRQHWLGTQLVNSYFRVRGKVSSHLFGICSGLKAVPRERRRSHNRASRML
                     AGLDAMASSAELAMKEVIRLGQAREHLERKLKGKRSSSSLPRVVDLLMARPIVSSSMI
                     VKELKVSHRAALDLVAELGVREVTGRGSFRAWGLI"
     gene            complement(58747..61257)
                     /locus_tag="ATU_RS23240"
                     /old_locus_tag="AGR_pTi_100"
                     /old_locus_tag="Atu6048"
     CDS             complement(58747..61257)
                     /locus_tag="ATU_RS23240"
                     /old_locus_tag="AGR_pTi_100"
                     /old_locus_tag="Atu6048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_010974842.1"
                     /translation="MVDFKKLREDKAKPKPVAPRDIFHSLPKAVGINDLYVSQAEALD
                     AWYPSRRNDKDVVVKLHTGGGKTLVALLMAQSTMNELGEPVLYLAPTTQLVEQVIAKA
                     TEYGIRAVPYTRGQPLASEFLDGNAVLVGAYESLFSGRSKFGVRGSAKPAVKVGGIIL
                     DDAHVALSSVRKAFSLTITSKDHLEVYQEMADRFRGAFDEVGRGGAFADITRGKDFGV
                     IEVPSWAWLSKVPEVREFLSQHVEGVDPYIWPLLRDNLAMCHCLFSRKSVTITPTFPP
                     VDLLPTFDDAKRRIYMSATISDDSEIVRTFGASPAAVGRPIQSSSLAGVGERMILVPE
                     LMPLGNVAITPMVKQIAKWIAGYAGVAILAPSGTVAKGWLDTAEYPETSEAVSHRIKD
                     MQAGSFKGPIVLANRYDGIDLAGQSCRLLIMDGLPQGTTDYDMFRTNVLADSAVNSLL
                     AQRIEQGLGRGSRGGGDFCVVVLTGSDLVAWIGRKKNLEHLTASSRVQLNVGQEVSEA
                     VASYQEIGETMLKCLNRDPDWVAYHASELAAATRPPGIDELSLKVAGAERRAFRLERV
                     GQYESAIQELEHLISSPDLVQDGQRRAWLSSLAARIAFHMNDDHKGQRLQTSAFATNN
                     NHIPPRIRPAYIPRPMAGPQSMAIVSRILEYQRRGSLIPAYNEAVSALVPDASPFQYE
                     EALKNLGAYLGFDAERPEAVHKTGPDVLWRTSGLFDFVIEAKSDKEKDNPLYKNDHAQ
                     LLEAEQWFRRCYPGRQSLRVSALPEPIADRKASTQGTYALKLEEVTKLVGAVRNLYVY
                     LIGQPGDRDVLQERCEAELRRTGLTPDGIKTIYLTEFK"
     gene            complement(61460..62647)
                     /locus_tag="ATU_RS23245"
                     /old_locus_tag="AGR_pTi_102"
                     /old_locus_tag="Atu6049"
     CDS             complement(61460..62647)
                     /locus_tag="ATU_RS23245"
                     /old_locus_tag="AGR_pTi_102"
                     /old_locus_tag="Atu6049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974843.1"
                     /translation="MEEHEIQKWLKEFPGARRAANGFFIGDERGEFYVTGIEPLDPDL
                     SNEELVYAPFCSKNEILRLRSLRSAHDYLLRIRANSVADSPRVTRVLAHRKRAFQQNG
                     RPWTLTSYYETVNLAPRRYLERLPKALRKSARSIPYGYVPTLEVNAACLKSLVGEVII
                     VSEALRYFLYFMTVCFHGAHYEFPMGDRIDAALIALRTMIGSEAQDFDIDPRAKLPAS
                     VDAAIKRDVDDMLEFTFGHEFSHLLLGHMEEASSTENLEDLKTYNHDLEFSADLHAIT
                     AIGSDKDAKLRLSNGAYHIFLFLHLIELLGSRFLDIPRFSVSETHPAPLERLYALKAA
                     LGDRNQPTKQHLDALVKHVGVVAEALTQRIDGAPRSDLLSFYGSMYLFGLGGEMREDR
                     IDF"
     gene            62881..63597
                     /locus_tag="ATU_RS23250"
                     /old_locus_tag="AGR_pTi_103"
                     /old_locus_tag="Atu6050"
     CDS             62881..63597
                     /locus_tag="ATU_RS23250"
                     /old_locus_tag="AGR_pTi_103"
                     /old_locus_tag="Atu6050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974844.1"
                     /translation="MVAVTRKSQMRAKLEVNPAAVADVLKVLARHNPGLSKPALAATG
                     KVMAVVSAVAARLSVEQQHRIADDETELAHIVEAAVAELAAKPGHVLAEVSVEKPVEV
                     SRGAGLGQSVDMEEGRRRLDEFATPTRIEDWAGPVAGPGDIEKKFGTKRSTLHDWHKR
                     GAVVGLLKGERKHVFPLAQFVDGRPVEGMPQVTKIIRNPRVAWQWLIQPKPSIGGTPL
                     DNLKMGNLDEVLDAAERDFG"
     gene            63606..64190
                     /locus_tag="ATU_RS23255"
                     /old_locus_tag="AGR_pTi_104"
                     /old_locus_tag="Atu6051"
     CDS             63606..64190
                     /locus_tag="ATU_RS23255"
                     /old_locus_tag="AGR_pTi_104"
                     /old_locus_tag="Atu6051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RES family NAD+ phosphorylase"
                     /protein_id="WP_010974845.1"
                     /translation="MKLDPQTVRELALAFLPQSYVRIIPVAHMSTPLGMGFGQSRFSS
                     PNQMFRLLYAAYDLATAIAETIVRDRFEGTQERVLDESEIEDWSVTEVTATDALILLD
                     LRTTGLLRLGVSTDAARGKEHQEGQRLSESIFRSYAVDGLLYSSRLTAADCVAVYDRA
                     VAAKLVASPAVELVRQADLIAALRFIGVSIRAGR"
     gene            64193..65185
                     /locus_tag="ATU_RS23260"
                     /old_locus_tag="AGR_pTi_bx90"
                     /old_locus_tag="Atu6052"
     CDS             64193..65185
                     /locus_tag="ATU_RS23260"
                     /old_locus_tag="AGR_pTi_bx90"
                     /old_locus_tag="Atu6052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_046033745.1"
                     /translation="MSVTVTSANFSGRFTALNGTKTLPATHADIIRSLLTVGYPSRRA
                     AVRTVGPWREKMLVAMATGYLDASLNTTAYFRSLEQSEKVGVSFLFGEAFTHWYAQSQ
                     MSVQYLVHVAGLASCRWGSPTAPVAPKAGAAPPPPKSRPDFIGIKRRERHVFESKGRI
                     RAPAASTVAKALGQVSALHTVNGRAPTTRCANFFMFKAGGAEGRVLDPPAKGDGITVT
                     FDLFEAITRAYSIILDQPVLDLSDQVGAGYVGREIDDGVFLGIDKEILALVRERPPTE
                     ATRRRRVAQVFSALEDRSQNYAGRQDRSVSSGLDGVLLLDRRSPRALRRFRTQG"
     gene            65282..65686
                     /locus_tag="ATU_RS23265"
                     /old_locus_tag="AGR_pTi_107"
                     /old_locus_tag="Atu6053"
     CDS             65282..65686
                     /locus_tag="ATU_RS23265"
                     /old_locus_tag="AGR_pTi_107"
                     /old_locus_tag="Atu6053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974847.1"
                     /translation="MTTLLGLTYISNEKVPLADLDDYVTVQVPSAGFDQHLGNYAPWF
                     WSIDRRGGGGVDFKQGKYDYWVRRIGSNQPIGFPVLSPTSKEEGWISVMDGRHRIMAI
                     VDSGRQAFAARLPRLLLGTAQMTIPGLEIFDL"
     gene            complement(65715..66107)
                     /locus_tag="ATU_RS23270"
                     /old_locus_tag="AGR_pTi_108"
                     /old_locus_tag="Atu6054"
     CDS             complement(65715..66107)
                     /locus_tag="ATU_RS23270"
                     /old_locus_tag="AGR_pTi_108"
                     /old_locus_tag="Atu6054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974848.1"
                     /translation="MDIPHVSRQPPEIGSRVKIYFDRTSGDLIIETPKGQRSRDFMGV
                     CISDAVFDTEATVRGSTRCIVTGTFLAVPGSRESRDIESEIRAQGRSHLEFYWWRDKT
                     WPLRKARLAFITKPHGGFPTSMVVDAGV"
     gene            complement(66431..67327)
                     /locus_tag="ATU_RS23275"
                     /old_locus_tag="AGR_pTi_110"
                     /old_locus_tag="Atu6055"
     CDS             complement(66431..67327)
                     /locus_tag="ATU_RS23275"
                     /old_locus_tag="AGR_pTi_110"
                     /old_locus_tag="Atu6055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974849.1"
                     /translation="MSRSRLPPLSALRAFEAAARRASFKAAAEELSVTPTAISHQIKQ
                     LEAHMGLRVLDRSPRAVTLTPQGKTLYEATASGFGEIERAVTRLLADTTPTTVTLSST
                     TAFLSHWLVPRMDTLRQAVPMIDLRLHTSNSVEDLRAGGVETAIRYGRGPFPGVVSTY
                     LCRDVMTPVCSARLGLSHLDDLRRAILIHIDGRNRPSPEPDWLRWCAQAGVADVDTSV
                     GPRFPDSMLAVQAAIAGQGVVIASRVLVADALAAGLLIAPFSGELAGDAYHFACAIGL
                     ETRADIVALREWFQVSLGPMCH"
     gene            67445..68317
                     /locus_tag="ATU_RS23280"
                     /old_locus_tag="AGR_pTi_113"
                     /old_locus_tag="Atu6056"
     CDS             67445..68317
                     /locus_tag="ATU_RS23280"
                     /old_locus_tag="AGR_pTi_113"
                     /old_locus_tag="Atu6056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018096456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhzF family phenazine biosynthesis protein"
                     /protein_id="WP_010974850.1"
                     /translation="MVELVAGLIDVFADAPLTGNPLAVVQDADDLTDDAMRRIAGEFN
                     QAETTFILRSARADWKLRSFTASGAEVFGAGHNALGAWLWLGEHGNLGSLTTARTLQQ
                     EIGQDVLPIELELIAGRVHGRMLQAPLRLSDALSDVAPLADALGLGLGDILSEPAPRP
                     ADTGAAHLMVRVRNAGTVDEARPDAGKLLAVLRKTAAEGCYVYAFDAGASNTAYARFF
                     NPTVGLWEDSATGTAAGPLAAYLAATGNLRNNELVIEQGTKMGRRSILHIRLKPEPEL
                     SGTGIVVLRGVIRL"
     gene            68748..69689
                     /locus_tag="ATU_RS23285"
                     /old_locus_tag="AGR_pTi_116"
                     /old_locus_tag="Atu6057"
     CDS             68748..69689
                     /locus_tag="ATU_RS23285"
                     /old_locus_tag="AGR_pTi_116"
                     /old_locus_tag="Atu6057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974810.1"
                     /translation="MDDSQRSVHSGAFNSRDAPRLSFPGCQTQRRGSREDGGIVSKQA
                     VSTTIGHSVPSYRPLALLSAFAVRVGPLVALVTVWQVACDFGAVRPVLLPAPSTIVRT
                     IWNMTLSGELAEHVAVSSARVLQGFGIAAVLALALGIVMGLIGPLNRLADLMVQVLKP
                     IPPIAWIPLSILWFGIGEEAKIFIIVLGAFFPILVSTLDAVHQTDVRYVELARVLEVP
                     RLNFIRQVMIPGALPQIMSGLRLGITMSWMCVVAAELIAASSGIGFLIMDGRVMSNAS
                     VVLAGMITLGVLGKLTDDALRFAERRLVRWRAGFSGL"
     gene            69698..70489
                     /locus_tag="ATU_RS23290"
                     /old_locus_tag="AGR_pTi_117"
                     /old_locus_tag="Atu6058"
     CDS             69698..70489
                     /locus_tag="ATU_RS23290"
                     /old_locus_tag="AGR_pTi_117"
                     /old_locus_tag="Atu6058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007359694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_045023452.1"
                     /translation="MTAAAFPATPPAATDHTLLVQGVSKSFSRPDGSEVRALDHVDLV
                     VRDGSVTCIIGASGCGKSTLLRIVAGLEPQFGGTVLLGGRPLKGPGLDRGIVFQDHRL
                     VPWMTVEANIAFSLHRLPKAEQRRVVTEKLKLVGLEGFGRSYPHQLSGGMAQRVAIAR
                     ALAHQPELLLLDEPFGALDALTRLQMQDEVLRIRHTDNLTTVLITHDIEEAIYLADEI
                     VVFSDRPGRVRARFTVELPHPRDRGDPAFARLRHELHAQFFHHRN"
     gene            70516..71478
                     /locus_tag="ATU_RS23295"
                     /old_locus_tag="AGR_pTi_119"
                     /old_locus_tag="Atu6059"
     CDS             70516..71478
                     /locus_tag="ATU_RS23295"
                     /old_locus_tag="AGR_pTi_119"
                     /old_locus_tag="Atu6059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aliphatic sulfonate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_010974852.1"
                     /translation="MLKKNIAKTATALVAAALLWAGSAAAETVNIGFMPFVPYSAILL
                     AKQKGWVDEEFTKAGLKDVEIKWHQFAGGPPVNEAFASGALDIAALGDTPSLIAFANG
                     IDTRFVGLACKGAKAEALIVLKDSSVKTVKDLKGKKVATLRGGNVHELLVLVLAEAGL
                     KISDVEFLNLGLQDMGIALTKGDVDAVLVWEPLLTKLDSEGVSRTLRDGAGLKSNLNP
                     IVALGSFAAKHPDVLKAYLQAVKRGAEALRSDPAGSAQVLAPVVGLTPKQTELAFSRF
                     EWKPTVTEADQAELADSVKFLLDNHFIRQTFEVSSFADQAFFNF"
     gene            71643..72524
                     /locus_tag="ATU_RS23300"
                     /old_locus_tag="Atu6060"
     CDS             71643..72524
                     /locus_tag="ATU_RS23300"
                     /old_locus_tag="Atu6060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
                     /protein_id="WP_046033746.1"
                     /translation="MLMGVRQVFGLGLMISDPITTADLVTVARTAEKAGFTTLTIGGR
                     ETILDPTTILAALAARTEQIGLVAAVNVDTALPYDFARRLASLDHLSSGRAGWKPYST
                     ADEPEEARIAEFVHAVSHLLDSWDDDAALYDKESGIYVDISKVHRLDHIGEYYRVAGP
                     LDIPRAPQGRPVLVREVLAADLAEGAWPTADIIEIVPVPGQSTNKPLAPRAEGNTTLL
                     SIVADTNDLASMHALLNDGDVDGATVRVAPRIDAVARAARDIGLWSKPRGSNLRDTLG
                     LSRPESLFALRRNGVSA"
     gene            72521..73768
                     /locus_tag="ATU_RS23305"
                     /old_locus_tag="AGR_pTi_123"
                     /old_locus_tag="Atu6061"
     CDS             72521..73768
                     /locus_tag="ATU_RS23305"
                     /old_locus_tag="AGR_pTi_123"
                     /old_locus_tag="Atu6061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
                     /protein_id="WP_010974853.1"
                     /translation="MTSRPLALLVNPLLCGHHEAAWRTERAQPERIHSLDYFQQLART
                     AERGRFDAVFMADFFIFNPAVMYSPRWEVEPVTLLSAVAQATENLGFIATGSAIFSDP
                     VEIARVFSTFDHATGGRAAWNIVTSGEPAAGANYGLDKPIPHAERYELGARNTEQVLA
                     YWDGAPVPDDVAPIARPVQGRPVLVQAGSSATGRDFAARFAELVFSAQWNFEAGRDFR
                     NDLRRRAVTHGRNPDDVRLILGLSFVIGSTEAEARSKKKALDDLILPHASHSWLQSFG
                     IDLTAFDFDEPLPRTLGNIDLYEGIKSRFSVISSLVDSTSPLTIRQLASALAGSRGHH
                     LVIGTPEQIADAAETWFLGGATDGFMVMPHELPAEFELFVDEVIPILRRRGLVDRDYR
                     GHTLRENLGLPISPSAPSWAFQT"
     gene            73926..74696
                     /locus_tag="ATU_RS23310"
                     /old_locus_tag="AGR_pTi_126"
                     /old_locus_tag="Atu6062"
     CDS             73926..74696
                     /locus_tag="ATU_RS23310"
                     /old_locus_tag="AGR_pTi_126"
                     /old_locus_tag="Atu6062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_010974854.1"
                     /translation="MTYPSQIPNISKLFDLSGRRAVITGGARGIGRAIADGFLEVGAD
                     VVCIDRGWESSDLPADNRQIVTADLSDRSDLKRGFDEAVERLGGQIDVLVNNAGIWDD
                     TPSLHMELEMWDRIIEVNLTAAFALSRHAARLMLPRGRGRIINIGSIRSLRGGHNAAA
                     YAASKGGIALLTQTLSNEWAPSGLRVNAIAPGAMVTVLTEKLRHDPEVVTRFIERIPA
                     RRWGSPADVAGLAIFLASDASDYVTGAIIPCDGGFLAG"
     gene            74856..76481
                     /locus_tag="ATU_RS23315"
                     /old_locus_tag="AGR_pTi_129"
                     /old_locus_tag="Atu6063"
     CDS             74856..76481
                     /locus_tag="ATU_RS23315"
                     /old_locus_tag="AGR_pTi_129"
                     /old_locus_tag="Atu6063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMC family oxidoreductase"
                     /protein_id="WP_010974855.1"
                     /translation="MKQVEADEFDFIVVGGGSAGAAVAARLAERADLRVLLLEAGRQQ
                     SGIRFRLPILTPFALAKEDAVWNFTTLPEPGLNGRELVWPRGRGLGGSSLINGMLWVR
                     GDPVEYDLWAASGCTGWSYGDLLDFFKRSETYIPGDPASRGQRGAVTVTRHRPADPLS
                     DAFLKACGNMQVSQQDDYNAGISEGAGYLQFNQRRGLRHGTDRAYLSPASRCANLTIR
                     EGAVANRILFEGKRAIGVEYRAADGLRCAIARREVVLSCGTVQSPKLLELSGIGDGEV
                     LGRAGIVPLVHLPGVGENLRDHLNVRVGFRTRFRGTLNDVQHSYVWKVRAMLCWLARG
                     GGPLSTIGATAHAFVRTRSDLERADVKIQMLHFSAPHNTGNISGRLDEFPGFSISTFV
                     LRPNSTGSSHIRSGAAAEPPAIVANYLSHEEDLRSMLGAFRFINRIASDSVFDDLMVS
                     RDNDLAGLQSDQDILEWAKTTGLTSYHPIGTCKMGTDSASVVDPRLRVIGVDGLRVVD
                     ASVMPTMPSSNTHGPTVMIGEKGAAMILEDSLS"
     gene            complement(76616..77530)
                     /locus_tag="ATU_RS23320"
                     /old_locus_tag="AGR_pTi_130"
                     /old_locus_tag="Atu6064"
     CDS             complement(76616..77530)
                     /locus_tag="ATU_RS23320"
                     /old_locus_tag="AGR_pTi_130"
                     /old_locus_tag="Atu6064"
                     /EC_number="3.8.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloalkane dehalogenase"
                     /protein_id="WP_012654999.1"
                     /translation="MKEHRHMTEKSPHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIV
                     FLHGNPTSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWFDA
                     LDLRNVTLVLQDYGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLSPEFVTRRAKL
                     RQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLP
                     VDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVTIRNLEIEAAG
                     AGIHFVQEEQPETIARLLDAWLTRIAGN"
     gene            complement(77527..78150)
                     /locus_tag="ATU_RS23325"
                     /old_locus_tag="AGR_pTi_131"
                     /old_locus_tag="Atu6065"
     CDS             complement(77527..78150)
                     /locus_tag="ATU_RS23325"
                     /old_locus_tag="AGR_pTi_131"
                     /old_locus_tag="Atu6065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655000.1"
                     /note="This protein belongs to a clade of uncharacterized
                     proteins related to peroxidases such as the
                     alkylhydroperoxidase AhpD; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxidase-related enzyme"
                     /protein_id="WP_010974856.1"
                     /translation="MSQATARHSVTSSPVSTGQLEEPISRLRVPTEDELPQKLRDIHM
                     RIRKKFGFVPNFLTALSANPGTALRIMAFYEHLFDQSNSHLSASERELIAVVTSVATG
                     CSYCVFNHRPALAAALGDRVLADRIARNHNDVTLAPRERALADLAQKLAATPHSVGSD
                     DFARLRAIGFSEPAILEVLEVSAFFSYGNRLTIALNVLPDPQFFVSA"
     gene            complement(78290..79495)
                     /locus_tag="ATU_RS23330"
                     /old_locus_tag="AGR_pTi_133"
                     /old_locus_tag="Atu6066"
     CDS             complement(78290..79495)
                     /locus_tag="ATU_RS23330"
                     /old_locus_tag="AGR_pTi_133"
                     /old_locus_tag="Atu6066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA/acyl-ACP dehydrogenase"
                     /protein_id="WP_010974857.1"
                     /translation="MGTYSLDTKLEAGQHLLDEVLLHTFQSRAADYDRENRFFFEDLA
                     DLKAVGYLQAALPVEFGGRGLTLSQVLAEQARLSYHAPATALAINMHLYWIGTAAYLW
                     RRGDHSTDWILEEAAAGRIFAAGHGEPGNDLGLAGSNVVAEPLADGGYRFHGRKIFTS
                     LSPVWDWLGIHALDASDPATPKIVHAFIRRQDPGHHTRETWDSHGVRATRSDDTILEG
                     VIAAKPYVTRVLPAGPPNDPFVDGIIASAVLPIGAVYYGIANRAFDIAVETAKSRVSP
                     ALSGRTYAHHPQTQVEIAKASIELDSIWAFLSRVAAEWTEGVDHGLLWPTKLLGAKQH
                     AVDGALRIVDRASKVAGASSLLRRNELERLTRDVRSGPFHPPNSDATHDLIGQIHLGV
                     FPPAAQAAE"
     gene            complement(79549..80118)
                     /locus_tag="ATU_RS23335"
                     /old_locus_tag="AGR_pTi_134"
                     /old_locus_tag="Atu6067"
     CDS             complement(79549..80118)
                     /locus_tag="ATU_RS23335"
                     /old_locus_tag="AGR_pTi_134"
                     /old_locus_tag="Atu6067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018436417.1"
                     /note="This protein belongs to a clade of uncharacterized
                     proteins related to peroxidases such as the
                     alkylhydroperoxidase AhpD; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxidase-related enzyme"
                     /protein_id="WP_010974858.1"
                     /translation="MTTIDGLARSQRISRLRIPDESELPEDIQALVDRHHHENWVRAL
                     SLNPDTARRFTGHFEHLFAATGRRLPLQDRELIAVVVSATNGCGVCEIHHTRAFGDLL
                     NDPGFARRVALDYHLADLSKRQRALADLAVKVTLSPKTISQADFEKLRDLELSDEELL
                     EAVETASWFNHTNRVTISLGILPDDKFFS"
     gene            complement(80275..81333)
                     /locus_tag="ATU_RS23340"
                     /old_locus_tag="AGR_pTi_136"
                     /old_locus_tag="Atu6068"
     CDS             complement(80275..81333)
                     /locus_tag="ATU_RS23340"
                     /old_locus_tag="AGR_pTi_136"
                     /old_locus_tag="Atu6068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_162936980.1"
                     /translation="MLRLEEIPMIPKQISEIEVPQATGKIETWKARVATAIVSREHRA
                     TWLPASALLILIGYFAFQQPAFLSPLNLTVMGAQAGPLLLISLGATFIVLMGSIDLSV
                     AAVAALASAISAVLLQKFGTGYTTALLAVLGFGIAAGLLNSVLSTVLRLPSFIATLAS
                     SSIFTGIMLHVLDGTALFVNDDDFSMLANGQIIPRVPNVLLLSLLLWLVLSLTTSHTR
                     FGRYIVAIGAGERVAKLSGIAINRYKTYAFVLSSTLAAIGGFFLLSRLGSATPSIGDG
                     YLLDTVAAIVVGGTALTGGVGGAQRTLLGVALITILSNGLNVSGVSTFTQEIVKGVVI
                     VIAVLTTIDRVSLQDIVK"
     gene            complement(81320..82906)
                     /locus_tag="ATU_RS23345"
                     /old_locus_tag="AGR_pTi_138"
                     /old_locus_tag="Atu6069"
     CDS             complement(81320..82906)
                     /locus_tag="ATU_RS23345"
                     /old_locus_tag="AGR_pTi_138"
                     /old_locus_tag="Atu6069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_010974860.1"
                     /translation="MRMSILSVESLTHSFGPSPALRDINLAIRSGEVVGIVGENGAGK
                     STLLNVLSGTLKPSRGTVAIGGTPVALENYYEANQRGIWRIFQDPALIGALPVYESLF
                     LGHEKRFTRFGVLNKAKMIDIARDLVRSMGIAVDVKHLMLNYDFATRQSLEVCRAILL
                     PKVLGLPSGFVLFDEPTTGLSRAEVVRLLESMGRLRRQGAGVAFVSHRLQEVFDVCDR
                     LIVLKDGAIVGEGPISQFDEAGLHRLMVGRAFESTTPGKRSTLNEEPFLVVKGLSRSS
                     RPSAGQRLTHLTDISFNVGKGEIVGIGGLLGSGKGQLLRVLAGVTSHRDGTVELGGMP
                     LAGSIAQRKQKGIAFIPGDRSNEAVVVTADVASNISLPSGHAGARGFSNAFGIWRSAR
                     EQNVARQMIVSLRIKAVSGQPLRTLSGGNQQKVSLARWIHREPVLLLIENPTAGVDVG
                     AKREIYALLRDLTAHGTSILYVTDDLPELISLSDRILIMRDGRIVSDIDNRQTLTTEH
                     ALVADMIGPASNEKTPIVAP"
     gene            complement(82903..84210)
                     /locus_tag="ATU_RS23350"
                     /old_locus_tag="AGR_pTi_139"
                     /old_locus_tag="Atu6070"
     CDS             complement(82903..84210)
                     /locus_tag="ATU_RS23350"
                     /old_locus_tag="AGR_pTi_139"
                     /old_locus_tag="Atu6070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_010974861.1"
                     /translation="MTSSKVTSSPLSSSLSRRRLLQAGAGLAVAGSGFLPSWEARAQS
                     FKSAPLHQLLLLSNEWNTIINDAAKRAAAVLGLPYSSATFNLNDGTAVTQAQSAAAAG
                     AKLFLIVSADGSSLKRIARTAQEGGGYVVNVGNNIPWTSPIDAGTGFAQAIVAREDGN
                     RGGNMYEAVKYTIGLAVKKFGPDAKFLHITGSKGSSYDNLRTAAVKRALAEFPGVTIA
                     GSLPGNWSAEEGQKATEDLIARHGVPNGIIAQNDGSLTGVLAALRGLKIEAGEEVLTV
                     GADGATDIFRAIKAGKVAATAFQSPAYYGVQAVARLFDALNGYEASAPERFVGFNGLL
                     VTKDDVDGVLARYVDNPNLPFDPKLLSHVISGDKWDPQAPLAPIRYDDYFTATGIEKP
                     ADYRPQADYAKSIETGEFDAVTKRYESAYKLKLDDFSFKGIKA"
     gene            complement(84344..85174)
                     /gene="aiiB"
                     /locus_tag="ATU_RS23355"
                     /old_locus_tag="AGR_pTi_140"
                     /old_locus_tag="Atu6071"
     CDS             complement(84344..85174)
                     /gene="aiiB"
                     /locus_tag="ATU_RS23355"
                     /old_locus_tag="AGR_pTi_140"
                     /old_locus_tag="Atu6071"
                     /EC_number="3.1.1.81"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acyl homoserine lactonase AiiB"
                     /protein_id="WP_010974862.1"
                     /translation="MGNKLFVLDLGEIRVDENFIIANSTFVTPQKPTVSSRLIDIPVS
                     AYLIQCTDATVLYDTGCHPECMGTNGRWPAQSQLNAPYIGASECNLPERLRQLGLSPD
                     DISTVVLSHLHNDHAGCVEYFGKSRLIAHEDEFATAVRYFATGDHSSPYIVKDIEAWL
                     ATPRNWDLVGRDERERELAPGVNLLNFGTGHASGMLGLAVRLEKQPGFLLVSDACYTA
                     TNYGPPARRAGVLHDTIGYDRTVSHIRQYAESRSLTVLFGHDREQFASLIKSTDGFYE
                     "
     gene            complement(85254..86468)
                     /locus_tag="ATU_RS23360"
                     /old_locus_tag="AGR_pTi_142"
                     /old_locus_tag="Atu6072"
     CDS             complement(85254..86468)
                     /locus_tag="ATU_RS23360"
                     /old_locus_tag="AGR_pTi_142"
                     /old_locus_tag="Atu6072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase family protein"
                     /protein_id="WP_010974863.1"
                     /translation="MTHHPHTWPTIDTPAFRTLVAIFRPVFAEIAEGSRQRDATRTLP
                     RDEVARLKALKFGALLLPKDKGGLGATPLELLALLVELAEADSNVAQIFRAHFGLLGQ
                     LLDEPSNAWTRRCIDIIGSGEIISAAATEVGNATLGKFSTSIIKTNEGHRLNGQKFYT
                     TGALFSEWMTVSGLNNADELIIALIKTTAPGTSIVDDWNGFGQRLTASGTAVFDQVLL
                     HDDDIAPSASRWPFLTAFAQLAHLATLVGIGRGASTAVADYVRSRKRTYSHAAASTAS
                     DDPQVLQLVGKVFANAHGANSIVLSAADAYHRAVAKGCRERTEIGKLEVQIYQAQVVV
                     HQLILDATTVLFDGLGASALSNELGLDRYWRNARAISSHNPVIYKERQIGDFAVNRSL
                     PPDLWTTGIGKA"
     gene            complement(86557..88152)
                     /locus_tag="ATU_RS23365"
                     /old_locus_tag="AGR_pTi_144"
                     /old_locus_tag="Atu6073"
     CDS             complement(86557..88152)
                     /locus_tag="ATU_RS23365"
                     /old_locus_tag="AGR_pTi_144"
                     /old_locus_tag="Atu6073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_010974864.1"
                     /translation="MIKLSRRTFNAALGIGALGTAIPGISFAQTTPVRGGTARIVAAS
                     EPAMLIELFQNTGNAGVGSRVIEGLLKVSFDRTFKPHLAESWDISADGKTYTFHLRPG
                     IKWHDGQPFTSADVAFSLLTLKETHPRRRVTFASLEKIDTPDPLTVVAQFKTPVPFLL
                     PALSGIASPIIPKHLYEETDIRANPYNAKPIGTGPYVFKEWERGSHILLERNPDYWIK
                     DLPLLDAVVTRFIVDVSARGAAFEAGDVDVGYHTPVPLDEIKRLGDDPRFGVETRGYE
                     LEGSLNQLFFRLDHPILSDLRVRQAFAHAINIDDYIRLVWKGYAVPSPTAIAPSMAEY
                     HDPSIGFYAFDKAKAEALLDEAGHKRGGDGKRFALRLTYNPVYGPTRVGAEFLRSAFG
                     DIGVDVAIQSYDYATYIKSVYTDAAFDIDLQHLANGYDPTDGIQRGYWSKNIKKGVPW
                     SNHSGYSNAEVDEIFEKGSIEIDPAKRKEYFVRFQHILHRDLPAVNLVQFQNLTLYRK
                     TLHNHTEDSSGHSVDFAAAWLGS"
     gene            complement(88210..89880)
                     /locus_tag="ATU_RS23370"
                     /old_locus_tag="AGR_pTi_146"
                     /old_locus_tag="Atu6074"
     CDS             complement(88210..89880)
                     /locus_tag="ATU_RS23370"
                     /old_locus_tag="AGR_pTi_146"
                     /old_locus_tag="Atu6074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_045023436.1"
                     /translation="MMAIPLLGVRDLSVRYHSRSGEAVAVENLSFDIAAGEAVALVGE
                     SGCGKSTTALALSNLLPDEASSSGEVTFDGLDLFRLPPKAWRPILGPRIGMIFQEPMS
                     ALNPVYTVGDQIAEVLHAHERLSRKAARSRVLELLDLVSMPEPHRRIASYPHELSGGQ
                     RQRAMIAQAIALTPLLLIADEPTTALDSTIQSQILELIDRLRRDLSMGLLLISHDLTL
                     VSRWTDRVVVMHNGKRMEELKAEHLFQESQHPYTKGLIGASIRLGDGRHASSERLNEI
                     RTHRNSNGTTSFEIRSPPVAAEPRTNATADALLEVEDLTVRYDPASKTPPAVDRVTFE
                     LLRGETLGLVGESGSGKSSLSKALSRLIPVAGGQILFEGQDITHAGGADLRAFRGRVQ
                     MIFQDPYSSLNPRRTVGDILDSVLHAHKYRNSADRQSRISEALDQVRLPRSAVERFPH
                     EFSGGQRQRIAIARALIVRPSLVICDEPVSALDVSVQAQILNLLADLKEEAGLSYLFI
                     SHDLAVVKYISDRIMVMKDGHIIERGNHQNLWSNPSHEYTRKLIAAAS"
     gene            complement(89877..90818)
                     /locus_tag="ATU_RS23375"
                     /old_locus_tag="AGR_pTi_147"
                     /old_locus_tag="Atu6075"
     CDS             complement(89877..90818)
                     /locus_tag="ATU_RS23375"
                     /old_locus_tag="AGR_pTi_147"
                     /old_locus_tag="Atu6075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974806.1"
                     /translation="MSGFDIESSTARMAAGEAPWSNIGNPVIARSVLRDFLSNPGATA
                     GLMTLSIIMLLALLAPWLAPGDPQSIVGPERLWPGENPDFLLGTDSLGRSVWAGLVHG
                     ARVSLLVGISATILGLVFGGLIGAIAGYCGGWIDDLIVRFIEIFQTIPSFVLLVVLVA
                     FATPTIGTVIVGIALVSWAMIARLTRAEFRSIREKDFVMAARASGISAPRIILQEILP
                     NALPSLIVVSSIMVASAILMESALSFMGLSDPNTVTWGSMIGASREVIRSHWYLTLMP
                     GGCIVLTVLALNLIGDGLNDALNPRIRRKVRSRKAVE"
     gene            complement(90818..91804)
                     /locus_tag="ATU_RS23380"
                     /old_locus_tag="AGR_pTi_148"
                     /old_locus_tag="Atu6076"
     CDS             complement(90818..91804)
                     /locus_tag="ATU_RS23380"
                     /old_locus_tag="AGR_pTi_148"
                     /old_locus_tag="Atu6076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010968091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_046033748.1"
                     /translation="MKRLTRVGRSLLRNLIQAVPTMFVIVTLGFFVLQLAPGDAADYM
                     AAESGAATQETVADIRRAFGLDLPLLDQLANYYTSLAHFSLGISPRYGVPVADLIMER
                     LPGTLTLMVLAIVIALLVGIAAGTIMALNATRAADRILSVASLLFYSVPTFWIGLIFI
                     IVFSVKLGWLPAGGMKTIGASSGGFGWLIDRVSYALLPATSLALYYMAIYARLTRSSI
                     LEVIGQDHVRTAKAKGLAPRQVVLRHVLRNALIPITTVAGIHVAGILGGAIVIETVFS
                     WPGMGRLAFDAVMAREYTLLLGIMLVSSVLVICVNAIVDIIQAALDPRIEVR"
     gene            complement(91801..93288)
                     /locus_tag="ATU_RS23385"
                     /old_locus_tag="AGR_pTi_150"
                     /old_locus_tag="Atu6077"
     CDS             complement(91801..93288)
                     /locus_tag="ATU_RS23385"
                     /old_locus_tag="AGR_pTi_150"
                     /old_locus_tag="Atu6077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_010974804.1"
                     /translation="MTVQQKIASGRSSGRTVSQERLNQLSEQTRRAIAQLEPVTLDWV
                     APVATDMDVAVIGGGQSGVAIAFGLRRAGIRRVQVFDAATPETAGVWNTIARMHTLRA
                     GKGFTGLEQGIPELTFEHWYVALHGDAAFAAMAEIPRTVWLDYLNWYRETAGIDVRWQ
                     HRLISIDPRSDAENAPLNLRFELQDKGVIDLSTQTIVLATGLDGLGEPYIPSVLSHTL
                     PPDRLVHTNDLINFSSLRGLSVGVVGAAASAFDAAAVALEHGAASVHQFVRHGDLVEA
                     NDQAAARPSADKLFFPEFDDAMRWRLILERRRRSSAPDAAIARACQHPNHYLHFNVAA
                     EQIVALGDDIVARTTTGDIMLDTVIAATGYRQNVYARPELTAAAPHILLWQDRVAAAE
                     GESGWSSHPYLGKGFELQEIEPGSAPWLKRIHVYTFAAIISHGIHAGDIGSAAIALPR
                     LIAAVARSLFIHARADYERLASLGPSIAVDRVAPSPVSGPWEAAP"
     gene            complement(93299..94525)
                     /locus_tag="ATU_RS23390"
                     /old_locus_tag="AGR_pTi_152"
                     /old_locus_tag="Atu6078"
     CDS             complement(93299..94525)
                     /locus_tag="ATU_RS23390"
                     /old_locus_tag="AGR_pTi_152"
                     /old_locus_tag="Atu6078"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
                     /protein_id="WP_010974865.1"
                     /translation="MTRDPHHTLTSTELTQNDPVPSPADFDESPVARIFRQPTMLGLF
                     LPLNAGGWSASHLPRTTSWDFGYNRNLVRIADELGFDIVFGLSQWLPKGGFGEVLNGT
                     SLDPFVTMAALATETKNILLASTVHILYGPWHPLHLARAGATLDHITNGRWGLNVVTG
                     HRRIEHEMFGGSQIEHDQRYRLADEFVNALKALWRSDEPVTFSGKSPWRIKEGFITPK
                     PRFGRPLLISATGSPAGIDFAARQSDIVFVTSPGGGSFEAARASLGAHTATVKAAAAR
                     NGRTIRVILNPIIVCRDTDQEAQEYYGAIVAAVEQRNVGGLHNIADTKDFDKRLVSDA
                     QAWAKSNDVNSVDAIAVGGNVRLVGSPQRIVEQLAALHAEGVDGFHISFFDYLPDLTH
                     FGRTVLPLMRAAGLRL"
     gene            complement(94522..95814)
                     /locus_tag="ATU_RS23395"
                     /old_locus_tag="AGR_pTi_154"
                     /old_locus_tag="Atu6079"
     CDS             complement(94522..95814)
                     /locus_tag="ATU_RS23395"
                     /old_locus_tag="AGR_pTi_154"
                     /old_locus_tag="Atu6079"
                     /EC_number="1.14.-.-"
                     /inference="COORDINATES: protein motif:HMM:TIGR03860.1"
                     /note="This protein belongs to a clade of FMN-dependent
                     monooxygenases, within a broader family of
                     flavin-dependent oxidoreductases, the luciferase-like
                     monooxygenase (LMM) family, some of whose members use
                     coenzyme F420 rather than FMN; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NtaA/DmoA family FMN-dependent monooxygenase"
                     /protein_id="WP_010974866.1"
                     /translation="MQRELHFTANYNLGLGLHPARWRLIDNPAQFLDVNAHIEVAQIA
                     EKAGFDAVFLSDFQSLPMEPPVEPWHALDPLLALSAIAARTESVGLIATVSTTFSEPY
                     ELARKLSSLDHISGGRAAWNIVTSYLPEAGWNFGMDLPTHDERYDRAEEFVSVAKALW
                     ASWGDGALLLDQAGGTFVDWKKVSHLNHVGMHFKVRGPLQVPTSPQGKPILVQAGSSE
                     VGLSFGARHADLIYSLQTNLEAAQAGYRRTKDAVRKAGRDPDRTLFMPGIYPVVGSTE
                     EEALRKVERLDALRDLAADARWFGIRLGVPLGGEDLDKPAPTRAQADFTPAVSTGISE
                     STWQMIERRPGATLREILLSSQGRNRFIAGTPEKVADEIELWFRSGAADGFNVSATHF
                     PDGFSSFTESVIPILQRRGIFRSEYRHSTLRGNLGLGE"
     gene            95923..96948
                     /locus_tag="ATU_RS23400"
                     /old_locus_tag="AGR_pTi_155"
                     /old_locus_tag="Atu6080"
     CDS             95923..96948
                     /locus_tag="ATU_RS23400"
                     /old_locus_tag="AGR_pTi_155"
                     /old_locus_tag="Atu6080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_052706884.1"
                     /translation="MVHIPVDYMFVIDFTIREVRRMRGTDFGNLRAFMMIVDSGSFVR
                     AAAALKIAPSTLSYTIQVLEGRLGTKLLQRTTRTVRLTEAGSRLARRLGPMMSEFDTL
                     MEDLTEPREKPSGTLKLCVPRMPMRLYMEPLLNGFEAAYTDITIDLTIGDVLVDIAVS
                     GFDAAVIPNRSIQDDLVSIRLGPELKRIVYASPRYLARFGAPSEPGDLVHHNCINFRG
                     PHTGAIYPWEFQRGQERFEVAVSGSLIVSDSTYTLSAALSGKGIGYGIEPISKPFLDD
                     GSLISLLEGWVAPHPGFMLCYPKNRNISAALKALLSYVRKQSRAGSRLNDDRVNGRLG
                     STHIVRT"
     gene            97030..97623
                     /locus_tag="ATU_RS23405"
                     /old_locus_tag="AGR_pTi_157"
                     /old_locus_tag="Atu6081"
     CDS             97030..97623
                     /locus_tag="ATU_RS23405"
                     /old_locus_tag="AGR_pTi_157"
                     /old_locus_tag="Atu6081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020809962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974802.1"
                     /translation="MKRARAGGRGSVFTPSDFLDVAARAAVDQALSRLARNGKLRRLT
                     RGLYDFPKVHPQLGALSPRPDDVAKALARETGSQVQIAGARAANALGLSTQVPAHSIY
                     LTDGPSRRVVLDKRVVDLRHASPKHLIAPGSAAGTVVQALRHVGAVRAADVAQIASRR
                     LSASDKKTLASNAVRAPAWMRSTLVSIANAMPSEIDG"
     gene            97873..98859
                     /locus_tag="ATU_RS23410"
                     /old_locus_tag="AGR_pTi_158"
                     /old_locus_tag="Atu6082"
     CDS             97873..98859
                     /locus_tag="ATU_RS23410"
                     /old_locus_tag="AGR_pTi_158"
                     /old_locus_tag="Atu6082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011992924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_012655016.1"
                     /translation="MTTAQQLISLLKSHVEGDDEQFLTIALQAAASEARRGHGKVAVQ
                     LRELVDAARANKDRTSGRKKAPVPIAQPRGDLANLVAVRYTDVRLSSMILPAELEARL
                     KRVILEQRQQHKLRSHGLAPRRKLLLIGPPGSGKTMTAAALAGELHTPLFTVQLDGLM
                     TKFMGETASKLRLVFSAMAETKGVYFFDEFDAIGAKRAERNDVGEIRRVLNSFLQFLE
                     EDESDGLVVAATNHPELLDPALFRRFDDVIEYALPSVEVATGILQARLSGFDTQDIDW
                     TKAVADAAGLSQAEIARAAADAAKLVVLSDRDRITQNDLSLAIAERKGAASQ"
     gene            98863..101373
                     /locus_tag="ATU_RS23415"
                     /old_locus_tag="AGR_pTi_160"
                     /old_locus_tag="Atu6083"
     CDS             98863..101373
                     /locus_tag="ATU_RS23415"
                     /old_locus_tag="AGR_pTi_160"
                     /old_locus_tag="Atu6083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S8 family peptidase"
                     /protein_id="WP_010974867.1"
                     /translation="MAEEPPRPLPHVYLPGHGNIQDYTARGGGGGTTVPVRDRAQHAV
                     KLTEALTRAVADAEAQLRAREPDLAGGTPGFYLEFELPSSQSEIVDKLENRQGRFPIE
                     LVSVRPIGEGGNAIAATVFVPERQRDYYLKKVAEYRDQDRIQRVEVDGEIVERNNGPK
                     NEVLVASLETARLAVARSLYTDDEAFFPVPGTAIWWEVWLRLGTRDTFATAAERLELP
                     VREHALQFPEREVLIVHASAETLGRIIAHTDTIAELRTARDTPAFFMEMDGAEQRAWA
                     AETAGRIVAPDGDRPAVCLLDSGSTRRHPLILPALAAVDQQAFDPGWNVEDTSNQGHG
                     GHGTQLSGVALYGDLTDVLAGAGQIILTHRLESVKILPDHGANDPDLFGAITAQSIAR
                     AEIVAPDRPRAICLALTSDGDHWRGRPSSWSAALDALAYGADNAPRLIAVSAGNIRED
                     IHQNDYLVRNDITPIESPAQAWNVLTVGAFTEKTAITDPVFNGWGVMAQVGDLMPRSR
                     TSVTWNHDWPLKPDVVFEGGNLGVDPATLIGDHLDDLALLTTYRTPEHRAFTTTGETS
                     AATALAARMGAQILGQRPDLWPETVRALIVHSAEWTPTMKAHLGGINKNALIRRYGFG
                     VPSLVRALGSLDNDVTMVIENQMQPFKTVGSKIETKDMVLHALPWPTEELEALGETQV
                     QLRITLSYFIEPNPGERGQTRRHSYASHGLRFALKPGDERPDVFLRRINAAAGARPPA
                     RAAGDAGWTLGPVLRNRGSLHGDIWEGNAVELSQRDAIAIYPTGGWWRENTGQRRGNT
                     AVRYALVATLRTAADVDLYTPISTPILPEVAPEILIET"
     gene            101725..103077
                     /locus_tag="ATU_RS23420"
                     /old_locus_tag="AGR_pTi_161"
                     /old_locus_tag="Atu6084"
     CDS             101725..103077
                     /locus_tag="ATU_RS23420"
                     /old_locus_tag="AGR_pTi_161"
                     /old_locus_tag="Atu6084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
                     /protein_id="WP_010974868.1"
                     /translation="MHLALYLEAGTHLGGWRLPESATSGGVDWALYKTVARRAEAAKL
                     DMLFVADKLSIDDNYGQHFADTVKYRLVTRPEPLTTLAALGAVTDHIGIGGTISSSYA
                     SPYAAARMLANIDHISGGRAAWNLVTSVSDGEARNFGREQHFGHEERYLRAIEFADVM
                     GKLWDSWEADALVLDKKSGVFADSTKFHYIDHEGDFFKIRGPINVPRPPQGRPVLIQA
                     GVSDRFQGIAAQNAEVIFVVHAELERARSFYKSFKEKVVEGGRSENAVKVLPGIVPVV
                     GRTRKEALDKERELKELILPEAGLSFMSASMNFDLAQFPQNAPFPDITDKITGSVGRF
                     QYVIKRAIEQKMTVAEVGKWYAESLSFFAPVGTPEEVASQLAHWYAQRACDGFVILPP
                     YIRRDEDLFLEGVVPVLQERGLFRREYPGTTLRETLGLERPANQFETRETTEKRRAAL
                     "
     gene            103100..104032
                     /locus_tag="ATU_RS23425"
                     /old_locus_tag="AGR_pTi_163"
                     /old_locus_tag="Atu6085"
     CDS             103100..104032
                     /locus_tag="ATU_RS23425"
                     /old_locus_tag="AGR_pTi_163"
                     /old_locus_tag="Atu6085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013203274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aliphatic sulfonate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_010974800.1"
                     /translation="MKTKSIIRLALSLALSVAATVASAQDVLRVGDQRGNARAVMDAS
                     GVLKDVPYQVEWSEFANAAPLLEALAAEALDAGSVGDAPLTFAAARGVKAKAIFATKY
                     EGNAIIVKNDAPYQGIKDLVRKKVAFVKGSAGHALILQSLKEAGLKEDAITPVFLPPA
                     EATLALTNGSVDAVSLWEPYISFATLKSGARIIVDGKNYPSLSYFIASEAAIEGKRDI
                     LKDFVARSAKARAWGLEHPQEYSKIIAQLVKIPDDVALGKQTRERHAPQLINADVEKL
                     QQSTIDLYYGAGIIDKKLKASDLLDDSFSPKQTD"
     gene            104051..104851
                     /gene="ssuC"
                     /locus_tag="ATU_RS23430"
                     /old_locus_tag="AGR_pTi_164"
                     /old_locus_tag="Atu6086"
     CDS             104051..104851
                     /gene="ssuC"
                     /locus_tag="ATU_RS23430"
                     /old_locus_tag="AGR_pTi_164"
                     /old_locus_tag="Atu6086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013957108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aliphatic sulfonate ABC transporter permease
                     SsuC"
                     /protein_id="WP_010974869.1"
                     /translation="MITTSAKTPTTAGRYLAQAFAPWAFPVIVVILWQIASSGGLLSQ
                     GILPSPLAVLEAAWSLAASGELVQHMAASFWRAAVGFGIGSALGLFFGFVNGLWRTGE
                     TLFDSSLQMLRNIPSLAMVPLVIMWFGIGEEAKIFLVAFATMFPIYLNTFHGIKSVDQ
                     GLIEMGRNYGLTRTGLVRDVILPGAMSSILVGVRYALGVAWIVLIVAETIAASSGIGL
                     LATNAREFLQSDVVVLSIILYALLGKLTDWLARLAENRWLRWHPSYQK"
     gene            104900..105679
                     /locus_tag="ATU_RS23435"
                     /old_locus_tag="AGR_pTi_165"
                     /old_locus_tag="Atu6087"
     CDS             104900..105679
                     /locus_tag="ATU_RS23435"
                     /old_locus_tag="AGR_pTi_165"
                     /old_locus_tag="Atu6087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_010974799.1"
                     /translation="MAKEVSLSNTSAGGAALDILGLWKGFDGTEVLKGLSLNVPAGQF
                     LSIVGRSGCGKSTLLRLIADLETIDGGTIQIDGNPLSEISGEVRMMFQDARLLPWRTV
                     LQNIGIGLPNPWQNRARKALAEVGLSEHADKWPSQLSGGQRQRVALARALIHRPRLLL
                     LDEPLGALDALTRLEMQDLIESIRARHGFTVLLVTHDVEEAIALGDRVIVMEQGEIVL
                     ELDIELARLRVRSSQAFTSIEEKVLSRVLNSRNAPSGDDCK"
     gene            105676..106623
                     /locus_tag="ATU_RS23440"
                     /old_locus_tag="AGR_pTi_166"
                     /old_locus_tag="Atu6088"
     CDS             105676..106623
                     /locus_tag="ATU_RS23440"
                     /old_locus_tag="AGR_pTi_166"
                     /old_locus_tag="Atu6088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010974870.1"
                     /translation="MNLDDIEAFIAVVGARSLSQAAAILSLTQSAISKRIQNLEKDLG
                     VTLLDRSVKPPVPTTVGLGVHEQCLNILREVDKLRLTLSARSNLTGGARLGLTQAVCD
                     VILADIVHLQQERWPELSIRATTGWANQIVEKLVDGQIDAAIVLMPTRKIFPHKVTAV
                     SLAQVEMAIVGPLGSGGDRAHRLVTLHKSGWILNPDGCGFRAELQRVHAVLNLPFKVN
                     LDTFARETQLEMVAAGLGLGLVPVPLLEMSPHRTKLEIITVSDFSLRAELWLCHAPTL
                     GALEPPISAFGARAATLFQGAAAPSRLVDFEAASQTITS"
     gene            106655..>107617
                     /locus_tag="ATU_RS23445"
                     /old_locus_tag="AGR_pTi_bx104"
                     /old_locus_tag="Atu6089"
                     /pseudo
     CDS             106655..>107617
                     /locus_tag="ATU_RS23445"
                     /old_locus_tag="AGR_pTi_bx104"
                     /old_locus_tag="Atu6089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654852.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase"
     gene            complement(<107516..107881)
                     /locus_tag="ATU_RS26605"
                     /pseudo
     CDS             complement(<107516..107881)
                     /locus_tag="ATU_RS26605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565686.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(107937..108998)
                     /locus_tag="ATU_RS23450"
                     /old_locus_tag="AGR_pTi_171"
                     /old_locus_tag="Atu6090"
     CDS             complement(107937..108998)
                     /locus_tag="ATU_RS23450"
                     /old_locus_tag="AGR_pTi_171"
                     /old_locus_tag="Atu6090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003551129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="non-homologous end-joining DNA ligase"
                     /protein_id="WP_010974872.1"
                     /translation="MTRPPRSKPLLRDTEPPIRSKPRRKRNPAQPQLLFDPIPDRVEP
                     ALALLKAKPPTGNEWSWELKWDGYRLAVHIEPQRIRILTRGGHDWTHRFPAIEQAARA
                     LGPATMIIDGEAVVLDDEGRPDFGLLQQSLGASGKQAGRRASHAVLYAFDLVYLDGHD
                     LRGVEYRSRRHLLEDTINGPTNEASAIRISETLDAEPAVLLEHVCRLGLEGIVGKRLD
                     QPYRSGRTGDWVKVKCIQSEAFFIVGYERSASYPAGFGSLALAAYRDGDLVHVGSVGT
                     GFKGAEIIRLRKILDTLRWKRKQPPLPHSGTADIVWVQPTLIAEIEFRAWTSDGKLRH
                     PSYKGLRERQDNADVYQLD"
     gene            109282..110034
                     /locus_tag="ATU_RS23455"
                     /old_locus_tag="AGR_pTi_172"
                     /old_locus_tag="Atu6091"
     CDS             109282..110034
                     /locus_tag="ATU_RS23455"
                     /old_locus_tag="AGR_pTi_172"
                     /old_locus_tag="Atu6091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017957069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ImuA family protein"
                     /protein_id="WP_010974873.1"
                     /translation="MTAARERVICDLRERIASLETSTAKKAGWLPFGVPEMDAVLPGG
                     GLAHGALHEFAGGGSGTVDGAAAALFAAGIAARTKGPIVWCLTRPDLFFPALAQVGLH
                     HDRIIFVESDKEEDVLANMEEGLSFGGLGAVVGELVRLPMVSSRRLQLAAERTGTMAL
                     AVRRWRRQTEANDFGQPTASTTRWRVSVMPSEDLPVPGVGRAQWLLELMRVKAGECAE
                     FLVRACDDKGCLDLSSGSADGSHSSRRSIHSA"
     gene            109955..111466
                     /locus_tag="ATU_RS23460"
                     /old_locus_tag="AGR_pTi_174"
                     /old_locus_tag="Atu6092"
     CDS             109955..111466
                     /locus_tag="ATU_RS23460"
                     /old_locus_tag="AGR_pTi_174"
                     /old_locus_tag="Atu6092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019565689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase Y family protein"
                     /protein_id="WP_046033749.1"
                     /translation="MTRVVSIYLPDLPTDRIRRADPSIPPEQAIAVIARSGSKRWVSA
                     ADAAARQAGVHVGMPAAKAQALFRGLMLVDADPAMDAAALERITLWALTLYSPIVAVD
                     GIDGIVMDTEGADHLQGGELPMVTKIANQFLARKLTPRVAIADTWGAAHACARAISRE
                     TVIVPSGETVRAVEKLPISLLRLPGNVVSDLRTLGFQTVGELANTPRAPLTLRFGPEI
                     GRRLDQMFGRACEPIDPIRTAELIEVSRAFAEPIGAAETIDKYVGRLVVQLIEELQRR
                     GLGVRRADLIVEKVDGVRQAIRAGTVKPVRDVAWLTKLFRDRTEKIEPGFGIEKLTLV
                     AVMAEPLEERQKSSSLVEDEVTDVTPLIDIYGNRGQRVYRVAPVASDVPERSVQRISP
                     AADPIEVTWVSHWRRPVRLLARPELIEAIALLPDRPPVSITWRGKRRKVKRADGPERI
                     FGEWWQRDAEMEAVRDYFVIEDEAGERLWVFRSGDGIDPDTGSHRWFVHGIFA"
     gene            111463..114726
                     /gene="dnaE"
                     /locus_tag="ATU_RS23465"
                     /old_locus_tag="AGR_pTi_175"
                     /old_locus_tag="Atu6093"
     CDS             111463..114726
                     /gene="dnaE"
                     /locus_tag="ATU_RS23465"
                     /old_locus_tag="AGR_pTi_175"
                     /old_locus_tag="Atu6093"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018900709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="error-prone DNA polymerase"
                     /protein_id="WP_010974875.1"
                     /translation="MSYAELQVTTHFSFLRGASSAQELFETAKALGIEALGVVDRNSL
                     AGIVRALEASRATGLRLVIGCRLDLADGMSVLVYPTDRAAYSRLTRLITLGKSRGGKN
                     NCLLHWDDVVAYTDGMIGILVPDLPDDLCGIQLRKMAELFGDRAYVSLCLRRRQNDQL
                     RLHEISNLATRFKVRTVVTNDVLFHEPGRRQLQDIVTCIRTRTTIDEVGFERERHADR
                     YLKPPEEMERLFPRYRQALARTMEIVRRCTFSLEELTYQYPEEAIVPGKDAQASLEHY
                     VWQCVPDRYPEGLPPDVLKVVRHELDLIRTMKYAPYFLTVFSIVRYARSQGILCQGRG
                     SAANSAVCYILGITSIDPSTNDLLFERFVSQERDEPPDIDVDFEHERREEVIQWIYRT
                     YTREKAALCATVTRYRARGAIRDVGKALGLPEDVIKALSSGMWSWSEEVCDRNVRELN
                     LNPDDRRLVLTLKLAQQLMGAPRHLGQHPGGFVLTHDRLDDLVPIEPATMKDRQIIEW
                     DKDDVEALKFMKVDILALGMLTCMAKAFDLIREHKDRDLDLSKIEQEDSVTYAMIRKA
                     DTLGTFQIESRAQMAMLPRLKPRTFYDLVVQVAIVRPGPIQGDMVHPYLRRREGKEAV
                     EYPTPELEAVLGKTLGVPLFQESAMRVAMVCAGFTGGEADQLRKSMATFKFTGGVSQF
                     KDKLVSGMVRNGYAPEFAEKTFSQLEGFGSYGFPESHAASFALIAYASSYIKCHYPEA
                     FCAALINSQPMGFYAPAQIVGDARAHGVEVRPVCINRSRWDCTLERIGNSDRHAVRLG
                     FRQVKGLAVADAARVVAARMNNAFVSVDDMWRRSGVPSEALVQLAKADAFLPSLKLER
                     RDALWAIKALRDEPLPLFAAAAEREMAAIAEQQEPGVALRQMTDGHNVIEDYSHTGLT
                     LRQHPIAFLRKDLSVRNIITCAEAMNSRDGRWVYTAGLVLVRQKPGSAKGVMFITIED
                     ETGPANLVVWPTLFEKRRRAVLGSSMMAINGRIQREGEVVHLVAQQLFDLSGDLTGLA
                     DRDEEFKLPAGRGDEFAHGSPGSSDTRDKSKPVVAPRDIFTPDLHIDTLKIKSRNFH"
     gene            114961..116079
                     /locus_tag="ATU_RS23470"
                     /old_locus_tag="AGR_pTi_177"
                     /old_locus_tag="Atu6094"
     CDS             114961..116079
                     /locus_tag="ATU_RS23470"
                     /old_locus_tag="AGR_pTi_177"
                     /old_locus_tag="Atu6094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974876.1"
                     /translation="MIRAFKSSSNSTEIINLDRDAIRENHRNGRQTNIMFDTNILIAI
                     ESAYKTGQRHQELKNAGVLELARLIEKTSKYGVFISPAAAYQELPPARRGDVEAAFDS
                     FLADYLPNFREDPNSIKVPYAGGKMDPEHFSALSLERQKAISCSYASLLAMNVIHRLE
                     ALNGLEKFALYIDYCAEVLDLISLKELTIARYVFAPENGLTDQLRTRKVAITNNFVKL
                     KKGGGKGLTPVKVLERIALNGANDLKLIAAADIVNNSREQFNFGIIEHDVWIATSDDK
                     LYEFCCACPGYMGRERGGPLARYVETHTDIKGTRYWRDSIEIQQRRLEERYFTVDREK
                     EMDSIVQSAFDIEADLLNGKADDYFRLRSWRSARVMHD"
     gene            116601..116777
                     /locus_tag="ATU_RS26610"
     CDS             116601..116777
                     /locus_tag="ATU_RS26610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015341926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_045024681.1"
                     /translation="MNTDLSLAQNHAFQLSRTLMVPVTLFRSGNEFGVLPSDELDDED
                     DLEIVHEYVPGGSH"
     gene            116838..117917
                     /locus_tag="ATU_RS23475"
                     /old_locus_tag="AGR_pTi_180"
                     /old_locus_tag="Atu6096"
     CDS             116838..117917
                     /locus_tag="ATU_RS23475"
                     /old_locus_tag="AGR_pTi_180"
                     /old_locus_tag="Atu6096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3991 domain-containing protein"
                     /protein_id="WP_010974798.1"
                     /translation="MLAPGRWPKVQIVILPAAPLPPLLFAMSGAGPQGAGKRNRRKGG
                     RKGASGIQMEKKELEELRDRVQCAAVLEQAGFAIDLKESTRRAVKFRGGGAIIIVIHE
                     GRGWFDPLSDAKGDVFGLVEHLDRVPFVEALDHVASLVDFVPKEPVWTHAAREIDLPA
                     GVSERWTKRRKPWPGSMTWRYLRDDRCVPEATIRAAIRHDLVREGPRGSMWAAHRDSE
                     GAVTGWEERGPEWRGFSTGGAKVLFRFGAIHAPRLCVTEAAIDAMSLAALESNRRDSL
                     YVSTGGGWAPATDAAIRLLAARKGILVVAATDNNAQGDIYADRLEAVARDANCGFERH
                     RPRHEDWNEDLCTQLRANSRRGAMS"
     gene            complement(117878..118474)
                     /locus_tag="ATU_RS23480"
                     /old_locus_tag="AGR_pTi_bx97"
                     /old_locus_tag="Atu6097"
     CDS             complement(117878..118474)
                     /locus_tag="ATU_RS23480"
                     /old_locus_tag="AGR_pTi_bx97"
                     /old_locus_tag="Atu6097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mobile mystery protein B"
                     /protein_id="WP_010974878.1"
                     /translation="MTDLFQEPEDATPLEPQEREGLLQSWITHRQDLNEAEQENIVEG
                     AAWARGRRRMPVGRMLTEDFMRTLHRRMFGEVWQWAGSFRTTERNIGIQAYRIPVELA
                     ALLDDVRYWVQHETFAADEIAIRFHHRLVAIHPFPNGNGRHARLAADLLVEKLGAEPF
                     SWGSGSLGDVGDLRTRYVAALQAADNHDIAPLLEFARS"
     gene            complement(118471..118932)
                     /locus_tag="ATU_RS23485"
                     /old_locus_tag="AGR_pTi_183"
                     /old_locus_tag="Atu6098"
     CDS             complement(118471..118932)
                     /locus_tag="ATU_RS23485"
                     /old_locus_tag="AGR_pTi_183"
                     /old_locus_tag="Atu6098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mobile mystery protein A"
                     /protein_id="WP_010974879.1"
                     /translation="MKDDARKRARRRLDERLRGLQPAEGFRAPPKGWVRALRDALGMT
                     GAQLGSRMGIRPQTVEAIEKSEASGTIQLSTLRRAAEALDCTLVYALVPNTSLEATVD
                     ERARKIAMRELQRVAHTMRLEAQGTDDGDLEARVQAYIRNQLSERDLWSEK"
     gene            119313..119915
                     /locus_tag="ATU_RS23490"
                     /old_locus_tag="AGR_pTi_186"
                     /old_locus_tag="Atu6099"
     CDS             119313..119915
                     /locus_tag="ATU_RS23490"
                     /old_locus_tag="AGR_pTi_186"
                     /old_locus_tag="Atu6099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012564798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1419 domain-containing protein"
                     /protein_id="WP_010974880.1"
                     /translation="MTVSPIRKVFEGIADRRQMYRLFDRHAQRLNRWESDDSALYRGE
                     WFEVAQAQHDHMFEILPPLFMRGDMFAMREFLTDSITSIFFTLTIDDRMRYFHGYCDL
                     SEKGSPERMRAAIVERETRPVRAMTREERLDHIWSSTHDDYRGYAGERWPERNHGKRT
                     VLFYGGRQGTVLELLDDLTDAQIASKLPVHLRYLPDAIAA"
     gene            119927..120328
                     /locus_tag="ATU_RS23495"
                     /old_locus_tag="AGR_pTi_187"
                     /old_locus_tag="Atu6100"
     CDS             119927..120328
                     /locus_tag="ATU_RS23495"
                     /old_locus_tag="AGR_pTi_187"
                     /old_locus_tag="Atu6100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003525126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3085 domain-containing protein"
                     /protein_id="WP_010974881.1"
                     /translation="MFTFSVTDIHVVMMRGRLDAYLNGGFRNPHYGVFPGRDEKPGLW
                     LIGDEGVYILSNGKLAVGQRPFVVYAEECDPKTNPDYWQYKRQHFGGDDGVEFLDGAM
                     LVKLIAASPGCTHLRIAFHEDSMQFTVIARD"
     gene            120457..125538
                     /locus_tag="ATU_RS23500"
                     /old_locus_tag="AGR_pTi_188"
                     /old_locus_tag="Atu6101"
     CDS             120457..125538
                     /locus_tag="ATU_RS23500"
                     /old_locus_tag="AGR_pTi_188"
                     /old_locus_tag="Atu6101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate dehydrogenase"
                     /protein_id="WP_010974882.1"
                     /translation="MSHDDPFTIDLFGNTALSSGLGLGVMAFASNFGPDDDPDPTTPA
                     PALPIAAVVRPSCPPCRARGLNFHLADDRGLARRWKDRARANIAAIRLAAEIEAGQRF
                     ATREEQETLIRFTGFGASDLANGVFRRPGELEFRKGWDEIGSDLEDAVCETDYASLAR
                     CTQYAHFTPEFIVRAIWSALQRLGWRGGRVLAPGIGTGLFPALMPEALRDLSHVTGVE
                     LDPVTARIVRLLQPRARILTGDFARTELPASFDLAIGNPPFSDRTVRSDRAYRSLGLR
                     LHDYFVARSIDLLKPGAFAAFVTSSGTMDKADSSAREHIAKTADLIAAIRLPEGSFRA
                     DAGTDVVVDILFFRKRKVAELEGDLSWLDIEEVRPATADEGAIRVNRWFAQHPDFVLG
                     THALTSGPFGETYTCLAPDGEDLDAALSAAVHLFPEGRYDGEPTQIDLDLEDATDDSP
                     RDLPAGRHVREGSFFVDNARGLMQVIDGEPVAVKVRKGRNADGIPEKHVRIIRKLISV
                     RDAVRVVLKAQELDQPWKDLQVRLRIAWSSFVRDFGPINHTTVSITEDPETGKTRESH
                     RRPNLQPFADDPDCWLVASIEDYDLENDTARPGPIFTDRVISPPAPPVITSAADALAV
                     VLNERGHVDRDHIAELLHRDPEDVVTELGSAIFRDPADGSWQMADAYLSGHVREKLKV
                     ADAAAGLDPAYERNVSALTAVQPVDLRPSDITARLGAPWIPAGDVVAFVKEMMGTDIR
                     IHHMPELASWTVEARQLSYLAAGTSEWGTDRRHAGELLSDALNSRVPQIFDTIRDGDS
                     EKRVLNVVDTEAAKEKLHKIKQAFQRWIWSDPDRTDRLARVYNDRFNNIAPRKFNGDH
                     LKLPGASGAFVLYGHQKRGIWRIISAGSTYLAHAVGAGKTMTMAASIMEQRRLGLVAK
                     AMQVVPGHCLAQAAREFLALYPTARILVADETNFSKDKRARFLSRAATATWDAIIITH
                     SAFRFIGVPAAFEQQMIHDELELYETLLLKVEDEDRVSRKRLERLKEGLQERLEALST
                     RKDDLLTIAEIGVDQIIVDEAQEFRKLSFATNMSTLKGVDPNGSQRAWDLYVKSRFIE
                     TINPGRALVLASGTPITNTLGEMFSVQRLMGHPALMERGLHEFDAWASTFGDTTTELE
                     LQPSRKYKPVSRFASFVNVPELIAMFRSFADVVMPADLREYVKVPAISTGRRQIVTSK
                     PTQAFKHYQMVLAERIKAIEEREGPPQPGDDILLSVITDGRHAAIDLRLVDADNDNEA
                     DNKLNNLISNAFNIWKATEGSTYLRHDGKSFELTGAAQMIFSDLGTISVEKTRGFSAY
                     RWIRDELIRLGVPASQIAFMQDFKKSEAKQRLFGDVRAGSVRFLIGSSETMGTGVNAQ
                     LRLKALHHLDVPWLPSQIEQREGRIVRQGNQHDEVDIFAYATEGSLDATMWQNNERKA
                     RFIAAALSGDTSIRRLEDLGEGQANQFAMAKAIASGDQRLMQKAGLEADIARLERLRA
                     AHLDDQHAVRRQIRDAERYVESATRRIAEIGQDIERLVPTSGDAFSMTVMGKVYAERK
                     EAGRALMKEILTQVQLQRQGEKVIASIGGFDLKYGGERFGRDGYRYTTMLMRTGADFE
                     IDLAVTVTPLGAVSRLEHALGDFEGERERNRQRLADARRRLASYQSRDEGRDFAFAGE
                     LAEKLRQLAEVDAALATDVDERIAA"
     gene            125894..127651
                     /locus_tag="ATU_RS23505"
                     /old_locus_tag="AGR_pTi_191"
                     /old_locus_tag="Atu6103"
     CDS             125894..127651
                     /locus_tag="ATU_RS23505"
                     /old_locus_tag="AGR_pTi_191"
                     /old_locus_tag="Atu6103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011427427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB N-terminal domain-containing protein"
                     /protein_id="WP_010974797.1"
                     /translation="MQILKLDPRALKDNPDDTRRSKSSPQSDALLLATVKAVGIIQPP
                     VISPEVDGGNGYIIQAGHRRVKQAIAAGLEEITVLVVAAANDNGAMRSMVENIAREPL
                     NPVDQWRGIERLVALGWTEEAIGVALALPVRQIRKLRLLANVLPAMLDHMALGDMPNE
                     QQLRTIAAASLDEQRQVWKAHKPKKSERADWYNISRALSKTRMFAKDASFGDDLAQAY
                     GIEWVEDLFAPADQDSRYTTNVEAFLGAQQEWMTNNLPKKGSIIEVNNWGQPELPKKA
                     ERVYGKPSKSDHVGMYLDRDGKVQSVAYRMPEDKKTKKGGSSKTGGLAEADDAIVDAP
                     KPRPDVTQKGQDMIGDFRTDALHEALGRAPIEDDMLMALLVLAFAGLNVRVDSGATDT
                     VFGSKRFKRHAARLIGEDGRLAFDVETLRVAARSMLIDVLSCRRGMSNGGVISRIAGH
                     AIGADNFLPNMGSEDFLLCLSRQAMEAAAKKANVLPRQKVRETRAALVDHFRQERFVH
                     TTALFAPDPQDIVDLIRSGEVLDDDSAEEADVDESALDGEEGLAAPEDEADLPDIADD
                     TPEAVDPDEEQDAYGIAAE"
     gene            127748..128221
                     /locus_tag="ATU_RS23510"
                     /old_locus_tag="AGR_pTi_193"
                     /old_locus_tag="Atu6104"
     CDS             127748..128221
                     /locus_tag="ATU_RS23510"
                     /old_locus_tag="AGR_pTi_193"
                     /old_locus_tag="Atu6104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974883.1"
                     /translation="MSAHLAFLAPIGTVLAWSNGQPRPPERHRKKLSAWKTNNSRGRL
                     IRKQDERGAGNINLPPSFTLHEGDYGSGGVIAIRVHRTFSLETSLMFTIVERPAVGSC
                     RVFDRPGDSADLVHLATSRKAAEEWLTTHGYPSAVLEDVTADEIAADVVEGRAAA"
     gene            128218..129105
                     /locus_tag="ATU_RS23515"
                     /old_locus_tag="AGR_pTi_195"
                     /old_locus_tag="Atu6105"
     CDS             128218..129105
                     /locus_tag="ATU_RS23515"
                     /old_locus_tag="AGR_pTi_195"
                     /old_locus_tag="Atu6105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003524941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974884.1"
                     /translation="MIDLPNTNTPDCTPGFPGVSFGLSCEGFPVARVGDHAFAMLPGH
                     AGRHYLATGWKIGRPLPEWRRGDFYGHCGELADEAAFSAHVLEQAEHQREIQALGRRN
                     TAPHVHTPWGSAQHSTTYAEGIEFHSTASHGGFRLSADRNRIVHPLLRADDGFYEEDC
                     AWAAVALTFPELFTSFEQRCASETLKDWEPDAWEAIFATVLAHGESHVKDRRAFKLEH
                     ASDWIVISALRSDHHPGMTEVIATRAGRRDHGGEERRFLVPSPEYEAGRFGYVIDEAR
                     HAAYDGPSSFASWKGRTAA"
     gene            129102..129410
                     /locus_tag="ATU_RS23520"
                     /old_locus_tag="AGR_pTi_196"
                     /old_locus_tag="Atu6106"
     CDS             129102..129410
                     /locus_tag="ATU_RS23520"
                     /old_locus_tag="AGR_pTi_196"
                     /old_locus_tag="Atu6106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003524942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974796.1"
                     /translation="MNRSIDRQAEMRRMEEACRQTRHQLDLIERQIIRRMTALIPSLG
                     RRKYGYRRGRPPEPEAFLTRYRSNLAAITAQRQPEIDALTRKLMRQQSAIAALQETMP
                     "
     gene            complement(129626..129931)
                     /locus_tag="ATU_RS23525"
                     /old_locus_tag="AGR_pTi_201"
                     /old_locus_tag="Atu6108"
     CDS             complement(129626..129931)
                     /locus_tag="ATU_RS23525"
                     /old_locus_tag="AGR_pTi_201"
                     /old_locus_tag="Atu6108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007530868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylphosphonate utilization protein"
                     /protein_id="WP_010974886.1"
                     /translation="MSDHSGDDYVYDEATGEWRPASEISAEKAKAAEVRDASGNVLAD
                     GDSVVLIKDLKVKGAGQTLKQGTVIRSIRLTDEPEEIDCRHDAIKGLVLRTEFVRKR"
     gene            130449..131048
                     /locus_tag="ATU_RS23530"
                     /old_locus_tag="AGR_pTi_204"
                     /old_locus_tag="Atu6109"
     CDS             130449..131048
                     /locus_tag="ATU_RS23530"
                     /old_locus_tag="AGR_pTi_204"
                     /old_locus_tag="Atu6109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974887.1"
                     /translation="MAKPATSSRQASRPAARVVQLRKGATIEMVRLTCPDEAQALRIV
                     ESFGTAILDSDGIRDMHERLIVETATGLSDGLGERAMQIHLQRIVGAYVGSAHGAGQF
                     YSKAVTEARDATAKGASDARDEDLDGPVGYDSAAQRKREFAADMGIQAHALRLAAEGA
                     VAAYEQIVGEAWKPFDRPVDNPGQALDRKAAAAQMDALG"
     gene            131360..132286
                     /locus_tag="ATU_RS23535"
                     /old_locus_tag="AGR_pTi_206"
                     /old_locus_tag="Atu6110"
     CDS             131360..132286
                     /locus_tag="ATU_RS23535"
                     /old_locus_tag="AGR_pTi_206"
                     /old_locus_tag="Atu6110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArdC family protein"
                     /protein_id="WP_010974888.1"
                     /translation="MSRKTANTRTDIYARITDRIVADLEKGVRPWVRPWSAANLSGRV
                     SRPLRHNGQAYTGLNVLLLWSESVASGFMSSTWMTLRQANELGAHVRKGESGATVVYA
                     SRFTKTEPDAGGGEVERDIPFLKAYTVFNCDQIDGLADHYYSRPEPIAKPLERIEHAD
                     RFFDNTGAVVRYGGDKAYYSPASDHIQLPRPEQFRDMASFVATRAHETLHWAGGPARL
                     NRDLSRYHKDRRERAFEEMLVELGAAMICADLGIVPELEPRPDHAAYIQSWAEILGSD
                     KRAIFNAAAHAQRAVAYLHDLQPQPASGQEAA"
     gene            132286..133200
                     /locus_tag="ATU_RS23540"
                     /old_locus_tag="AGR_pTi_207"
                     /old_locus_tag="Atu6111"
     CDS             132286..133200
                     /locus_tag="ATU_RS23540"
                     /old_locus_tag="AGR_pTi_207"
                     /old_locus_tag="Atu6111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003524948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974889.1"
                     /translation="MLLVPNFTGDGASSPIRLRALSLGAGVQSTTMALMAAHGEIGPI
                     PDCAIFADTGWEPKAVYDHLEWLMSPNVLPFPVHVVSGGNILDNLMDAAAGKRWASIP
                     AFAKTVTPAGSARPVLDEDDDGELVQIGSRATSRETVSIGMMRRACTADYKIVPIRRK
                     VRELLGLTRKRSPDHAVAEQWIGISTDEASRIKPSFEDWQINRWPLIEQRMSRRDCLA
                     WLRRHDYPTPPKSACIGCPFHDNGRWRHMRDHDPEAWAEAVIVDRALRTGIRRIRGEV
                     YLHRSCVPLDEADLSTAADHGQLDLWPI"
     gene            133895..134212
                     /locus_tag="ATU_RS23545"
     CDS             133895..134212
                     /locus_tag="ATU_RS23545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF736 domain-containing protein"
                     /protein_id="WP_046033433.1"
                     /translation="MAVIGEFTTNGNNSIIGNVRTLTVSMKARLNPIERVSRDAPDFR
                     ITGGNGVEVGAGWNKVSNDGEPFISVKLDDPSFNAPITAALWPGEKEGDYALIWNRPK
                     REA"
     gene            complement(134304..134915)
                     /locus_tag="ATU_RS23550"
                     /old_locus_tag="AGR_pTi_211"
                     /old_locus_tag="Atu6113"
     CDS             complement(134304..134915)
                     /locus_tag="ATU_RS23550"
                     /old_locus_tag="AGR_pTi_211"
                     /old_locus_tag="Atu6113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012561645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zeta toxin family protein"
                     /protein_id="WP_162936981.1"
                     /translation="MRLKKLEQPVFLIVAGPNGSGKSSVYANADLELEGRSVWIVNPD
                     LLAGRISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTDKYRRLVEAAE
                     AVGFAIWLFYTVLDSPERSIERIKLRVAKGGHDVPADKVRARYARSLDQLPWFLERAD
                     RAWIWDNSGATPKLIGEKQDGVIGLDENALAVVASAVKSIATE"
     gene            complement(134896..135138)
                     /locus_tag="ATU_RS23555"
                     /old_locus_tag="AGR_pTi_212"
                     /old_locus_tag="Atu6114"
     CDS             complement(134896..135138)
                     /locus_tag="ATU_RS23555"
                     /old_locus_tag="AGR_pTi_212"
                     /old_locus_tag="Atu6114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003524955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003524955.1"
                     /translation="MAKVVVKKLNGPKSGVRGKAVTEKRVRDSSSGQFVTVRTIDAKS
                     QTFGQDLTYVFSRNVAKARRDNKAVTGVVDRAPEKA"
     gene            complement(135219..136625)
                     /locus_tag="ATU_RS23560"
                     /old_locus_tag="AGR_pTi_213"
                     /old_locus_tag="Atu6115"
     CDS             complement(135219..136625)
                     /locus_tag="ATU_RS23560"
                     /old_locus_tag="AGR_pTi_213"
                     /old_locus_tag="Atu6115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003524954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974890.1"
                     /translation="MRHPSIATVVTPQSKSVNQSDAFLASKHNQLNLFNSIDHLVTDE
                     KKLSDSERGAIEHHIVNIRAAIARSLWSKEIYVGTSLLDEHVLACAKQGGGGVPGKML
                     SDLASAGVERPGFVLYPLTSFGMKMEMLPWRNSGLKSHILFRAAGFAVSAQTNSVARA
                     HDRLIEMARGLGIRQRIERGDIEHFSHAAQWLKTNPLLLVKLTSHTGDMYENQFVYTL
                     KIRSAASALLMLHALSVERDGSIDKFSSSAHVNNWETLDIRHYLIGEGRRSGKIATRR
                     VPMNVSALDLARLSDVAAVVSTEAMETNTMKRFERQIVAALKTVEQGYFRHVHLTAGS
                     KMEARFYKRIVTALDWFRQSFGSHANESEAIVALAVAFETLLTDHYQPGVAERIKRRA
                     GICMKGVPRVSSYQQSIIELYHARGSIVHTGELGQAANVERAQAAFARCFCSLVSRLP
                     SGRLPNSDPVRNLLGDTG"
     gene            complement(136688..137539)
                     /locus_tag="ATU_RS23565"
                     /old_locus_tag="AGR_pTi_214"
                     /old_locus_tag="Atu6116"
     CDS             complement(136688..137539)
                     /locus_tag="ATU_RS23565"
                     /old_locus_tag="AGR_pTi_214"
                     /old_locus_tag="Atu6116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003524951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4160 domain-containing protein"
                     /protein_id="WP_003524951.1"
                     /translation="MILFHHTSVSLAEGILASQLNQGHVTRRSGEPLRDVVWLTTDES
                     HEGHGLTTGEQLDPVHRSYVEKVEQTKLRQGRVWTADKTRIRIKVKIPTRDRKLFNYS
                     AWSRKNDGPRFAKFMGLSCVESVAGLNASELERVMLMTATKEETWYLSFRPIDPKEFE
                     EVLYRTEDGYIPYDFELHGRHELENVGIYTAGKAALEELREVVASRHGYDRASAVVTC
                     ADLAMPANVVVRGGGINVAFNLDTLRRLEGSAGPYEEEIVAWIERHRLDLNEAWQKSR
                     TQLISYS"
     gene            137671..138156
                     /locus_tag="ATU_RS23570"
                     /old_locus_tag="AGR_pTi_215"
                     /old_locus_tag="Atu6117"
     CDS             137671..138156
                     /locus_tag="ATU_RS23570"
                     /old_locus_tag="AGR_pTi_215"
                     /old_locus_tag="Atu6117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX domain-containing protein"
                     /protein_id="WP_010974891.1"
                     /translation="MAEIPIRCFAVSVVLLRSVAAGPEVLLLRRNRTLIGEWCQIAGG
                     IEEGEKAWEAALREVREETGLTCGQLYSADICEQFYEADRDAISMLPVFVGFVDAGAT
                     VVINHEHSEFRWVPFETALGMVPFAGQRHVLKHVQAEFVQRQPVRHLLIYSTRGAMRC
                     S"
     gene            complement(138208..138444)
                     /locus_tag="ATU_RS23575"
     CDS             complement(138208..138444)
                     /locus_tag="ATU_RS23575"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_046033434.1"
                     /translation="MAVAAKAIETKASFGHTRSIEVCVGVASQNRIAHDMPRNQLLNS
                     LPARRWHNRFRHPAHTTSRLRTCRSFDAIADGCV"
     gene            138624..138941
                     /locus_tag="ATU_RS23580"
                     /old_locus_tag="AGR_pTi_217"
                     /old_locus_tag="Atu6119"
     CDS             138624..138941
                     /locus_tag="ATU_RS23580"
                     /old_locus_tag="AGR_pTi_217"
                     /old_locus_tag="Atu6119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003517402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF736 domain-containing protein"
                     /protein_id="WP_045024646.1"
                     /translation="MAVIGEFNTNGNNSIIGNVRTLTVSMKARLNPIERVSRDAPDFR
                     ITAGNGVEVGAGWNKVSNDGEPFISVKLDDPSFNAPITAALWPGEKEGEYALIWNRPK
                     REA"
     gene            139260..139430
                     /locus_tag="ATU_RS26615"
     CDS             139260..139430
                     /locus_tag="ATU_RS26615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004676096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162936979.1"
                     /translation="MTISLEIQREELRAEFRNACDPAERRRIAAELEMVQAELATIEA
                     EQDGRISAEPPF"
     gene            complement(139472..139750)
                     /locus_tag="ATU_RS23585"
                     /old_locus_tag="AGR_pTi_222"
                     /old_locus_tag="Atu6120"
     CDS             complement(139472..139750)
                     /locus_tag="ATU_RS23585"
                     /old_locus_tag="AGR_pTi_222"
                     /old_locus_tag="Atu6120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HU family DNA-binding protein"
                     /protein_id="WP_010891541.1"
                     /translation="MTTTNEIADKIAAEQSLTKAQAKTIVESVFKQITDAALAGAETS
                     IPSFGKFKLKDTPEREGRNPATGATIKIAASKKLTFTPGKAVKDALNG"
     gene            complement(139890..140147)
                     /locus_tag="ATU_RS23590"
                     /old_locus_tag="AGR_pTi_223"
                     /old_locus_tag="Atu6121"
     CDS             complement(139890..140147)
                     /locus_tag="ATU_RS23590"
                     /old_locus_tag="AGR_pTi_223"
                     /old_locus_tag="Atu6121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WGR domain-containing protein"
                     /protein_id="WP_010974892.1"
                     /translation="MEDKETCPVHLHRIETAQNMRRFYILAIQPTLFGGASVIRNWGR
                     IGSGGQTMMQTFDHPDDANTALSCLERTKRRRGYRDAGNTE"
     gene            complement(140387..140854)
                     /locus_tag="ATU_RS23595"
                     /old_locus_tag="AGR_pTi_225"
                     /old_locus_tag="Atu6122"
     CDS             complement(140387..140854)
                     /locus_tag="ATU_RS23595"
                     /old_locus_tag="AGR_pTi_225"
                     /old_locus_tag="Atu6122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thermonuclease family protein"
                     /protein_id="WP_052706870.1"
                     /translation="MHRSMWVAVLVVGGVLCFERTGGLDRTVALTSAPAEDTLSASFS
                     ICGEDRRMNCVVDGDTFWFKGEKIRIADIDTPELSPPRCTAERVKGEAAKARILVLLN
                     VGPFSMSTGLRDEDRYGRKLRTVSRKGQSFGEILVGEGLARRWDGARRSWCDS"
     gene            complement(140854..141252)
                     /locus_tag="ATU_RS23600"
                     /old_locus_tag="AGR_pTi_226"
                     /old_locus_tag="Atu6123"
     CDS             complement(140854..141252)
                     /locus_tag="ATU_RS23600"
                     /old_locus_tag="AGR_pTi_226"
                     /old_locus_tag="Atu6123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012650582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974893.1"
                     /translation="MRHWRTTWYSLIGPLMIWVAFIIVTPFFGVAAIASLGVLPLLGE
                     TALKAIGMFCVLILAPLAALAEIAPPIVTREEVRWRNRNSETLFEGAEIWEDIAFLPP
                     ILNRIRSTKGKRRQQADERDTAANARTVST"
     gene            complement(141249..143225)
                     /gene="traG"
                     /locus_tag="ATU_RS23605"
                     /old_locus_tag="AGR_pTi_bx12"
                     /old_locus_tag="Atu6124"
     CDS             complement(141249..143225)
                     /gene="traG"
                     /locus_tag="ATU_RS23605"
                     /old_locus_tag="AGR_pTi_bx12"
                     /old_locus_tag="Atu6124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ti-type conjugative transfer system protein
                     TraG"
                     /protein_id="WP_010974894.1"
                     /translation="MTMNRLLLLILPAIIMLAAMFATSGMEQRLAAFGTSPQAKLMLG
                     RAGLALPYIAAVAIGIIGLFAANGSANIKAAGLSVLAGSGVVITIATLREVIRLNSIA
                     SSVPAEQSVLAYADPVTMIGASIAFISGMFALRVAIKGNAAFATTAPKRIGGKRAVHG
                     EADWMKIQEAAKLFPERGGIIIGERYRVDRDSVAAMPFRADDRQSWGAGGKSPLLCFD
                     GSFGSSHGIVFAGSGGFKTTSVTIPTALKWGGGLVVLDPSSEVAPMVCEHRRQAGRKV
                     IVLDPTAGGVGFNALDWIGRHGNTKEEDIVAVATWIMTDNPRTASARDDFFRASAMQL
                     LTALIADVCLSGHTETEDQTLRRVRANLSEPEPKLRARLTKIYEGSESDFVKENVSVF
                     VNMTPETFSGVYANAVKETHWLSYPNYAGLVSGDSFSTDDLADGGTDIFIALDLKVLE
                     AHPGLARVVIGSLLNAIYNRNGNVKGRTLFLLDEVARLGYLRILETARDAGRKYGIML
                     TMIFQSLGQMREAYGGRDATSKWFESASWISFAAINDPDTADYISKRCGDTTVEVDQT
                     NRSTGMKGSSRSRSKQLSRRPLILPHEVLHMRSDEQIVFTSGNPPLRCGRAIWFRRDD
                     MKACVGENRFHRTGTGTDTHTEHAPPWQKEGTRP"
     gene            complement(143212..143427)
                     /gene="traD"
                     /locus_tag="ATU_RS23610"
                     /old_locus_tag="AGR_pTi_234"
                     /old_locus_tag="Atu6125"
     CDS             complement(143212..143427)
                     /gene="traD"
                     /locus_tag="ATU_RS23610"
                     /old_locus_tag="AGR_pTi_234"
                     /old_locus_tag="Atu6125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system coupling
                     protein TraD"
                     /protein_id="WP_032489195.1"
                     /translation="MAKSMTSNARKKDTREKIELGGLIVKAGLRYEKRALLLGLLVDG
                     GRRLKGDEEERSRLTAIGAEAFGHDDE"
     gene            complement(143432..143728)
                     /locus_tag="ATU_RS23615"
                     /old_locus_tag="AGR_pTi_235"
                     /old_locus_tag="Atu6126"
     CDS             complement(143432..143728)
                     /locus_tag="ATU_RS23615"
                     /old_locus_tag="AGR_pTi_235"
                     /old_locus_tag="Atu6126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraC family protein"
                     /protein_id="WP_010974896.1"
                     /translation="MKKPSSKIREEIARLQDQLKQAETREAERIGRIALKAGLGEIDI
                     EESQLQAAFEEVAKRFRGGKGSATGKRQAGESRTGTEPSAALASGADEGGSGEA"
     gene            143987..147289
                     /gene="traA"
                     /locus_tag="ATU_RS23620"
                     /old_locus_tag="AGR_pTi_237"
                     /old_locus_tag="Atu6127"
     CDS             143987..147289
                     /gene="traA"
                     /locus_tag="ATU_RS23620"
                     /old_locus_tag="AGR_pTi_237"
                     /old_locus_tag="Atu6127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ti-type conjugative transfer relaxase TraA"
                     /protein_id="WP_010974791.1"
                     /translation="MAIAHFSASIVSRGDGRSVVLSAAYQHCAKMEYEREARTIDYTR
                     KQGLVHQEFILPADAPKWVRALIADCSVAGASEAFWNKVEAFEKRSDAQLARDLTIAL
                     PRELTSEQNIALVRDFVEKHILGKGMVADWVYHDNPGNPHIHLMTTLRPLTEDGFGAK
                     KVAVIGEDGQLVRTKSGKILYELWAGSTDDFNVVRDGWFERLNHHLTLGGIDLKIDGR
                     SYEKQGIDLEPTIHLGVGAKAISRKAEQQGVRPELERIELNEERRSENTRRILKNPAI
                     VLDLIMREKSVFDERDVAKVLHRYVDDPAVFQQLMLRIILNPEVLRLQRDTIEFATGE
                     KVPARYSTRAMIRLEATMARQAMWLSDKETHAVSTAVLAATFGRHGRLSEEQKAAIEC
                     IAGPARIAAVVGRAGAGKTTMMKAAREAWELAGYRVVGGALAGKASEGLDKEAGIESR
                     TLSSWELRWNRGRDVLDNKTVFVMDEAGMVASKQMAGFVDAVVRAGAKIVLVGDPEQL
                     QPIEAGAAFRAIVDRIGYAELETIYRQREDWMRKASLDLARGNVEKALALYNANARIV
                     GERLKAEAVERLIADWNRDYDQTKTTLILAHLRRDVRMLNVMAREKLVERGIVGEGHV
                     FRTADGERRFHAGDQIVFLKNETLLGVKNGMIGHVVEAVPNRIVAVVGDRDHRRHVVV
                     EQRFYSNLDHGYATTIHKSQGATVDRVKVLASLSLDRHLTYVAMTRHREDLQLYYGCR
                     SFAFNGGLAKVLSRKNAKETTLDYERGKLYREALRFAENRGLHIMQVARTMLRDRLDW
                     TLRQKTKVSDLVHRLRALGERLGLDQSPKTQTMKEAAPMVTGIKTFSGSVADTVGDKL
                     GADPTLKQQWEEVSARFRYVFADPETAFRAVNFDTVLADKEAAKAVLQKLEAEPASIG
                     ALKGKTGILASKTEREARRVAEVNVPALKRDLEQYLRMRETATLRIVTEEQALRQRVS
                     IDIPALSPAARVVLERVRDAIDRNDLPAALGYALSNRETKLEIDGFNQAVTERFGERT
                     LLSNVAREPSGKLYEKLSDGMRPEQKEQLKQAWPIMRTAQQLAAHERTVQSLKQAEEL
                     RQTLRQAPVLKQ"
     gene            147286..147816
                     /gene="traF"
                     /locus_tag="ATU_RS23625"
                     /old_locus_tag="AGR_pTi_240"
                     /old_locus_tag="Atu6128"
     CDS             147286..147816
                     /gene="traF"
                     /locus_tag="ATU_RS23625"
                     /old_locus_tag="AGR_pTi_240"
                     /old_locus_tag="Atu6128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer signal peptidase TraF"
                     /protein_id="WP_010974897.1"
                     /translation="MSKRAVIRFLGVAGLVLSGATVMGLIGGYRVNVTPSEPLGLWRV
                     EKLRRPVQSGDLVFVCPPHNAFFEEAWLRGYLRSGLCPGWFAPLIKSVLALPGQRVEI
                     ADRIVIDGHPVSASTVSATDSEGRAIAPFAGGVVPPGFLFLHSSFASSYDSRYFGPIP
                     DSGLLGLARPVFTFDP"
     gene            147737..149002
                     /locus_tag="ATU_RS23630"
                     /old_locus_tag="AGR_pTi_241"
                     /old_locus_tag="Atu6129"
     CDS             147737..149002
                     /locus_tag="ATU_RS23630"
                     /old_locus_tag="AGR_pTi_241"
                     /old_locus_tag="Atu6129"
                     /function="enhances conjugal transfer of pTiC58"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018240794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraB"
                     /protein_id="WP_032489196.1"
                     /translation="MIHDTSARSRTAVFSAWRGRCSRLTRDRWRVALLILLSIAVGAV
                     GWSGEALLLPTAMLFPLLWAQSPSRLVAGAVSAGYFLTASRGLPQGVANFYAADFWHG
                     LLLWLAASAGFVAVHAAFWPARLQKRLPGRGALGWGKPVRYLAAAVLMGLPPFGITGW
                     AHPLTAAGILFPGFGWWGLGATTAGLAMMTSRYWPAAAIALGGFWFWSAATWTQPVLP
                     DGWKGVDLEQGQTLGRDGSLDHHRDLIATVRAAAGAETRVIVLPESALGLWTPTVARL
                     WQAGLRGADVTVIAGAAVIDPGGYDNVMVTVSEGETRILYRERMPIPVSMWQPWLQWT
                     GQGGGAQAHFFANPAVDLAGTRIAPLICYEQLIVWPILHSMLFSPAAIVATGNGWWTE
                     GTSIVAIQQAGVIAWAKLFGRPVVTAFNT"
     gene            149016..149645
                     /locus_tag="ATU_RS23635"
                     /old_locus_tag="AGR_pTi_243"
                     /old_locus_tag="Atu6130"
     CDS             149016..149645
                     /locus_tag="ATU_RS23635"
                     /old_locus_tag="AGR_pTi_243"
                     /old_locus_tag="Atu6130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraH"
                     /protein_id="WP_010974898.1"
                     /translation="MVDSALIKECSDPGLKPAIVEQFIERAGAPDPLAVTVRSGNRIV
                     LVPRPTTPDEALALIRQNLGRNIVRVGLTQYPAGLGIVEAGQLKPDLIEPCENIKMGT
                     ALFAKVYRIVTKWYGNPTESEVLPQVFEDAIIAWQTGYFEGTAVFRAADPGDVKLPEP
                     DPGVEAETSEAGSDKMKGGNVDTALEAEPADPNKAGIRIDLSGIGARGK"
     gene            150171..150479
                     /locus_tag="ATU_RS23640"
                     /old_locus_tag="AGR_pTi_bx139"
                     /old_locus_tag="Atu6131"
     CDS             150171..150479
                     /locus_tag="ATU_RS23640"
                     /old_locus_tag="AGR_pTi_bx139"
                     /old_locus_tag="Atu6131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor TraM"
                     /protein_id="WP_003523843.1"
                     /translation="MESEDATLTKKVELRPLVGLTRGLHPADLEKLTIDAIRAHRRLV
                     EKADELFQALPESYKSGKEVGGPQHLCYIEASIEMHAQMSAVSTLISILGYIPNATVN
                     "
     gene            complement(150638..152377)
                     /locus_tag="ATU_RS23645"
                     /old_locus_tag="AGR_pTi_246"
                     /old_locus_tag="Atu6132"
     CDS             complement(150638..152377)
                     /locus_tag="ATU_RS23645"
                     /old_locus_tag="AGR_pTi_246"
                     /old_locus_tag="Atu6132"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003508204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing methyl-accepting
                     chemotaxis protein"
                     /protein_id="WP_010974789.1"
                     /translation="MNILNRGANACAVLAALSKSQAMIEFDLSGRILTANDNFCRALG
                     YELSEIIGKHHSMFVEPAFVKSADYKAFWAKLAAGNFDQQQYKRIGKGGKEVWIEASY
                     NPVMRRGKPVKVVKIATDITAQKLKVAEDAGKIEALSRAQAIIEFTPTGDVLTANENF
                     LSALGYSLSEIQGKHHSMFCEPSYTASPDYRNFWKMLAGGDLMADEFMRLGKGGRKVF
                     IQASYNPIFDMNGRVFKVVKFATDVTTRVENVEQLAGCLNSLADGDLAQQIEKPFIPS
                     LERLRTDFNAASDKLKRAMATVADNARAISAGSSEIRTAADELAKRTEQQAASVEETA
                     AALEEITTTVKDSSRRAEEAGQLVARTREHAEHSGEVVRDAIGAMDQIETSSREISNI
                     IGVIDEIAFQTNHLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAKAAKEIKTLIT
                     SSGSQVQSGVSLVTKAGSALQEIATQVHDINTNVVAIVEAAREQSNALGEINKAVNSV
                     DQGTQQNAAMVEEQTAASHSLAREAAALFELLEHFRFDDSGRTQAFAGQVHQPSVAPV
                     AKQSTRAAQVFAA"
     gene            complement(152480..152809)
                     /locus_tag="ATU_RS23650"
                     /old_locus_tag="AGR_pTi_247"
                     /old_locus_tag="Atu6133"
     CDS             complement(152480..152809)
                     /locus_tag="ATU_RS23650"
                     /old_locus_tag="AGR_pTi_247"
                     /old_locus_tag="Atu6133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974899.1"
                     /translation="MMSVTSYTFYTYSQATADDQAHWLHGHTTVQFFDSLEAARQELV
                     KLHEDLSQDLDLTWRPLYLEKIETRAVTKELLLSLLNRNMEALIERHMIVDTISSFSS
                     SALSGHN"
     gene            complement(152839..153543)
                     /gene="traR"
                     /locus_tag="ATU_RS23655"
                     /old_locus_tag="AGR_pTi_249"
                     /old_locus_tag="Atu6134"
     CDS             complement(152839..153543)
                     /gene="traR"
                     /locus_tag="ATU_RS23655"
                     /old_locus_tag="AGR_pTi_249"
                     /old_locus_tag="Atu6134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator TraR"
                     /protein_id="WP_010974900.1"
                     /translation="MQHWLDKLTDLAAIQGDECILKDGLADLAEHFGFTGYAYLHIQH
                     KHTIAVTNYHRDWRSAYFENNFDKLDPVVKRAKSRKHVFAWSGEQERSRLSKEERAFY
                     AHAADFGIRSGITIPIKTANGSMSMFTLASERPAIDLDREIDAAAAAGAVGQLHARIS
                     FLQTTPTVEDAAWLDPKEATYLRWIAVGMTMEEVADVEGVKYNSVRVKLREAMKRFDV
                     RSKAHLTALAIRRKLI"
     gene            complement(153761..155218)
                     /locus_tag="ATU_RS23660"
                     /old_locus_tag="AGR_pTi_251"
                     /old_locus_tag="Atu6135"
     CDS             complement(153761..155218)
                     /locus_tag="ATU_RS23660"
                     /old_locus_tag="AGR_pTi_251"
                     /old_locus_tag="Atu6135"
                     /EC_number="2.4.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose phosphorylase"
                     /protein_id="WP_010974901.1"
                     /translation="MQNKVQFITYVDRLTRGGFRQLKELVDGKFAGLFGGVHVLPFFN
                     PIDGADAGFDPTDHTIVDPRLGDWEDVRALSGSVEIMADLIVNHVSSQSGAFTDFIAK
                     GSASEFADMFMTFDKVFPDGATEEDLLRIYRPRPGLPFSKVTLADGTQRMLWTTFTPE
                     QIDIDVHSAKGTTYLETILDRFSEANVTAIRLDAAGYAIKKAGSSCFMIDDTYAFLEE
                     VAGKARNRGMEVLVEIHSYHRDQIEIAKKVDRVYDFALPPLILHALFTGDATPLAKWL
                     AISPRNAITVLDTHDGIGVIDVGAHSDGRAGLLEPQAIDNLVGEIHRRSDGQSRQATG
                     AAASNLDLYQVNCTYYDALGRNDNDYLIARAIQFFAPGIPQVYYVGLLGGVNDMDLLA
                     KTGVGRDINRHYYGNDEIGTALETPLFHRLSNLIRFRNTHPAFGGALKATIADAGALV
                     LSWQHGDAFAELKISFADRKASIAASGQSEMQIVE"
     gene            complement(155270..156922)
                     /locus_tag="ATU_RS23665"
                     /old_locus_tag="AGR_pTi_bx25"
                     /old_locus_tag="Atu6136"
     CDS             complement(155270..156922)
                     /locus_tag="ATU_RS23665"
                     /old_locus_tag="AGR_pTi_bx25"
                     /old_locus_tag="Atu6136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007789939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na/Pi cotransporter family protein"
                     /protein_id="WP_003523851.1"
                     /translation="MESTIVLINLCGAVALLLFGLAQVKDGASRALGARLRTGLASGT
                     KSSARSFLSGFVATVALQSSTATALMVSSFVERELIKPRMAQVVLLGANVGTAVTAWI
                     VATGIEWVSPALLFVGIILYRGGSTSRQGAGTALLGIALMLLSLHLLSNATEPLRHSP
                     ALAAFIGLLENAWPVAMIFSAAIAFASSSSLAAVVLILSLTSTGILSGGLVVALVLGA
                     NFGGAIPPVIASLSASAAARRVTLGNLIVRAIGCLLILPVADILASWLSMLPVPASKL
                     PVDAHLALNIGLALLAMPFSRLLARWMGVLIPASEQADNTPKFLDPDELSTPVVALTS
                     AAREVLGVGDLIERMLLRVSDAFQQNNAARLKDIAQLERQVDRLQQEVKVYLSKLGRT
                     GLSEDEGRRSIVIIDYAINLEHIGDIVEKGLLPEVTKKIAHGLKFSDDGFSELTQLFQ
                     LTVDNLRIAQTILITRDINLARQLMERKVEVRHMEKQSSERHLERLRDGRTDSLQTSS
                     LHLDILRDLKRINAHIVSVAHPIMDEQGLLGESRLIAGGSAD"
     gene            complement(156962..157108)
                     /locus_tag="ATU_RS23670"
     CDS             complement(156962..157108)
                     /locus_tag="ATU_RS23670"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162936978.1"
                     /translation="MGSSPPCSPTGTLINRKLDKVCDENRFPLETNQDGTRLADLCCE
                     QPLR"
     gene            157464..158240
                     /locus_tag="ATU_RS23675"
                     /old_locus_tag="AGR_pTi_255"
                     /old_locus_tag="Atu6138"
     CDS             157464..158240
                     /locus_tag="ATU_RS23675"
                     /old_locus_tag="AGR_pTi_255"
                     /old_locus_tag="Atu6138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR/GlpR transcriptional regulator"
                     /protein_id="WP_010974787.1"
                     /translation="MVFNSTQDRQAKIVELLRDEQFLAIGRLTEHFQISVATARRDLS
                     ELHEAGLLRRTHGGAVSVTQVTQDKPNAARAVWNRAEKAAIAGVVAGMIVEGDTVLLD
                     AGTTALEVAKKLADRRNLTFISNGLDIVEELTRGEGKSIYSVGGEYTETNRSFRGPLA
                     EQFIRQFNVDKLILNAASIDVDRGLICTSSPVNASVARAMIEVSSRVIVVADHSKFTK
                     SSLSVTARIEDVGVIVTDSGTRTIIETIPEKLRKKFVVAN"
     gene            158298..159863
                     /locus_tag="ATU_RS23680"
                     /old_locus_tag="AGR_pTi_257"
                     /old_locus_tag="Atu6139"
     CDS             158298..159863
                     /locus_tag="ATU_RS23680"
                     /old_locus_tag="AGR_pTi_257"
                     /old_locus_tag="Atu6139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_010974902.1"
                     /translation="MLKTNRRNFMMGTAAIAVASTAGAKFTFAQERRALRLGVNGLPN
                     SLEPVNAISNVGPRIVNQIFDTLIARDFFAKGAPGNAIDLVPALAESWERIDEKSVRF
                     KLRQKVMFHDGVELTADDVAYTFSSERLWGPEAIKKIPLGKSYSLDFDEPVVEDKYTV
                     TLRTKTPSYLIETFVASWMSRIVPKEYYKKLGAVDFGNKPVGTGPYKFVEFVAGDRVV
                     LEANDAYWGPKPTASKITYQIVAEPATRVAGLISGEYDIITTLTPDDIQLINSYPDLE
                     TRGTLIENFHMFTFNMNQEVFKDKKLRRALALAVNRPIMVEALWKKQASIPAGFNFPN
                     YGETFDPKRKAMEYNVEEAKRLVKESGYDGTPITYHTMGNYYANAMPALMMMIEMWKQ
                     IGVNVVMKTYAPGSFPPDNQTWMRNWSNGQWMTDAYATIVPEFGPNGQVQKRWGWKAP
                     AEFNELCQKVTVLPNGKERFDAYNRMRDIFEEEAPAVILYQPYDVYAARKDVHWKPVS
                     FEMMEFRNNLSFG"
     gene            159924..160862
                     /locus_tag="ATU_RS23685"
                     /old_locus_tag="AGR_pTi_258"
                     /old_locus_tag="Atu6140"
     CDS             159924..160862
                     /locus_tag="ATU_RS23685"
                     /old_locus_tag="AGR_pTi_258"
                     /old_locus_tag="Atu6140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007819484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_046033426.1"
                     /translation="MSNLLTVRDLIVQVPARDITIINGVSFSLDAGQTLGLVGESGCG
                     KSMTCYAIAKALPRGISQTGGTIELDSGPKADGKPAIAMIYQDPTSSLNPVHSIGYYL
                     ESSLYRHQGLEGNDARLEAMRLLERVGIDRAKSRLRSYPHEFSGGMNQRVMIAHALAA
                     KPKLMIADEPTTALDVTTQAQILHLLEELRSETGMALLIVSHDLGVIARLADRAAVMY
                     CGKIVETAPVAELLERAAHPYARALIGCMPTIDADDLEPPVPIPGSVPLLDNLPAGCY
                     YHPRCPRASEQCSVSFPGPVNVGAFHDAACYHPVSP"
     gene            160859..161878
                     /locus_tag="ATU_RS23690"
                     /old_locus_tag="AGR_pTi_260"
                     /old_locus_tag="Atu6141"
     CDS             160859..161878
                     /locus_tag="ATU_RS23690"
                     /old_locus_tag="AGR_pTi_260"
                     /old_locus_tag="Atu6141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_010974903.1"
                     /translation="MSAPLLQARGVTKVFRLKSGLFVKPSVHVAVNSIDLELAPRERV
                     GVVGESGSGKSTLGRLLLGLTSTTEGEVLFEGLAHTDRSARDWSTFRKETSLVQQNPL
                     SALNPQMTIGEQIAEAVWVHRVANRAGARDRAATMLDRVGLSSAMMNRYPHQMSGGQR
                     QRVVIARALILDPKLVVFDEAVSALDVSVQAQVVALLRQLWQELDLAYVFITHDLRIV
                     RHLVDRIVVMYLGRVVETGDIKSVYAWPRHPYTRALLASVPTMDPTVRNIEPPIKGEL
                     DAGKVMTGCAFRSRCPFAIERCAKETPLLRPAGGQLAACHRAEEFPRSIVAQTDPAQM
                     MEVAR"
     gene            161875..162801
                     /locus_tag="ATU_RS23695"
                     /old_locus_tag="AGR_pTi_261"
                     /old_locus_tag="Atu6142"
     CDS             161875..162801
                     /locus_tag="ATU_RS23695"
                     /old_locus_tag="AGR_pTi_261"
                     /old_locus_tag="Atu6142"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974904.1"
                     /translation="MISFILARLVRAIIVMMLTVTFVFIILRLGGDPARAMLGENATP
                     EALAAFRTAWGLDRSIPEQFLIYLASALRGDFGVSAADGREVFTVISERIPKTLTLTI
                     SAFVLSILVGIPAGIIAAVRRDSAADKSVMAGAVLGYSVPNFLLGLTLIFVFAVWFRV
                     LPSSGSSTWQHAILPVATFGLVNAAAIARFARSALIEVLEQPYIAAARADGIPKWEVV
                     IRHALPNAAIPMVTMLGFVAAGLLGGSAIVETVFAWPGLGSGFVRAITLSDLNVVQAM
                     ILLFTAFMVTINLIVDVLYAVLNPKIRLQKNG"
     gene            162794..163654
                     /locus_tag="ATU_RS23700"
                     /old_locus_tag="AGR_pTi_263"
                     /old_locus_tag="Atu6143"
     CDS             162794..163654
                     /locus_tag="ATU_RS23700"
                     /old_locus_tag="AGR_pTi_263"
                     /old_locus_tag="Atu6143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010974905.1"
                     /translation="MANTTLSLPKRQFLKSARRIPISIWLCLIWIAVVVFVDITAQWL
                     APFDYLQQSPLARFAPPGAPGHLLGTDYLGRDVLSNILVATQTSLMIALVGSLICAFI
                     GTTLGFLAAHFGGWVDNLIMGFADAKASVPFIIFALGVLAFLGSSPLILLMLVGVASF
                     ERYARLTRGLVLSANQEGYAEAARIVGVPSLRIYVRHVLPNIAGPLIVQITLNFPDII
                     LLESGLSFLGLGIQPPETSLGLMVADGRNYIAIAWWLIALPGVVIVLTTLSISLLGDY
                     LRDRFDARLR"
     gene            163670..164470
                     /locus_tag="ATU_RS23705"
                     /old_locus_tag="AGR_pTi_266"
                     /old_locus_tag="Atu6144"
     CDS             163670..164470
                     /locus_tag="ATU_RS23705"
                     /old_locus_tag="AGR_pTi_266"
                     /old_locus_tag="Atu6144"
                     /function="agrocinopine phosphodiesterase"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010891519.1"
                     /translation="MNPLRMTPETIRLGGHRGHSAGAPENTLAAFRKAFEFGGRNVTC
                     ETDLGITRDGELVLIHDKTVDRTTDGHGIVHDMTYSELSKLDAGSWFSSEFVGERVPL
                     LKDALQLARELGIIYQLELKIYDANDVFFPKLRTLIDELGCADLLQFSSFDYVQLKAV
                     KEAIPEVPTVGLMHSRLIDPAALARQANLDAMNIEIYHFASGEARQLHNEGFAAFCYL
                     PTGYHEKLAQYGVDVETQLVQWVREGQLDQLLGDDVAQVARLKDRANG"
     gene            164463..165281
                     /locus_tag="ATU_RS23710"
                     /old_locus_tag="AGR_pTi_267"
                     /old_locus_tag="Atu6145"
     CDS             164463..165281
                     /locus_tag="ATU_RS23710"
                     /old_locus_tag="AGR_pTi_267"
                     /old_locus_tag="Atu6145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase family protein"
                     /protein_id="WP_010974906.1"
                     /translation="MADRDTSTSHAGETASIVEEIARKAGDLALAHFRSLSSLSVETK
                     GHLDLVTKADKEVETFLIAQLREAFPADGIFGEEGGEIKGRSGRIWVIDPIDGTFNFV
                     RGGQNWAISIGLYENKRPTFGVIFAPVRNLMFVGGKTVETKLNGMAVKPLPPLDMSRA
                     STGFSYHPSASTADRLEVIRYISDDLNISFRFCGAATLSMVEVAMGETDGYVSLGDST
                     WDVMAALPILSNLGVADTIDWDRTDLSAKLRFACGSHDFLEKVKPLLDKVALAA"
     gene            165281..165739
                     /locus_tag="ATU_RS23715"
                     /old_locus_tag="AGR_pTi_268"
                     /old_locus_tag="Atu6146"
     CDS             165281..165739
                     /locus_tag="ATU_RS23715"
                     /old_locus_tag="AGR_pTi_268"
                     /old_locus_tag="Atu6146"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004432806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_010974907.1"
                     /translation="MRRASDNNGHRSPLVDADQCGAICVRSTSLVNSEMEALLITSRE
                     TGRWVIPKGWSEGRKKLHRVAREEAWEEAGVRGRVCKNPYGHYRYDKKVSHDEFIPCL
                     VQVHLLTVSTLKDDFPEKGQRQIRWFSPEEASGLVIEPELKQLLLKLRQQ"
     gene            165760..166743
                     /locus_tag="ATU_RS23720"
                     /old_locus_tag="AGR_pTi_269"
                     /old_locus_tag="Atu6147"
     CDS             165760..166743
                     /locus_tag="ATU_RS23720"
                     /old_locus_tag="AGR_pTi_269"
                     /old_locus_tag="Atu6147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003523862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldose 1-epimerase family protein"
                     /protein_id="WP_010974785.1"
                     /translation="MDIELLKKTPDLRAIADIRLATLEDGPARGQRLLIARNATGIAF
                     EVALDRGFDISSLSFRGTNIGWNSPTQMRFPMVDPGSEGGWAFMRNFDGFLVTCGLDH
                     ISRPLEVDIAHYNHPHLKTKSMPQHGRISTEKARLVGYDVDPESGEIFCEGIVRQASV
                     FGENLELRRRITLPVFGQALRIDDTVTNRGFRPSGHAIIYHLNYGYPFLDQNLEITGL
                     PELLAAKLVVDPPRPSDDYGEYVDSVDSLEIPEADPIVVSNRELDISVGLTFTRDQLN
                     KLAIWRAYQSGVFALGVEPRTDLAQDRPLLLPGESCKNSLQVELTDCCCSN"
     gene            166778..>166867
                     /locus_tag="ATU_RS23725"
                     /pseudo
     CDS             166778..>166867
                     /locus_tag="ATU_RS23725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008551328.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
     gene            167536..167880
                     /locus_tag="ATU_RS23730"
                     /old_locus_tag="Atu6149"
     CDS             167536..167880
                     /locus_tag="ATU_RS23730"
                     /old_locus_tag="Atu6149"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_045231714.1"
                     /translation="MIGMAAGFRVEFAHLTFVLKMDNAFAANLGAIPTAFHQFRDGQS
                     WSTVACGLCDERLKHQSRKYNFDHITDETRFKFVDISFVATLNRRLIIEAKALNSHTV
                     YVDSGIDFDESM"
     gene            167883..169142
                     /locus_tag="ATU_RS23735"
                     /old_locus_tag="AGR_pTi_272"
                     /old_locus_tag="Atu6150"
     CDS             167883..169142
                     /locus_tag="ATU_RS23735"
                     /old_locus_tag="AGR_pTi_272"
                     /old_locus_tag="Atu6150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010892482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_010974908.1"
                     /translation="MITSSISGTDQQFQNATQPKELDPDAVPVSRLDSEGHEIFAEWR
                     PKRPFLRREDGVFLVLRADDIFLLGTDPRTRQIETELMLNRGVTRGAVFDLIRYSMLF
                     SNGEVHVKRRSAFAKTFAFRMIDALRPEITKLTEHLWDDVPRVDDFDFAEMYASKLPA
                     LTIASVLGLPFGDAPFFTRLVYNVSRCLSPSWGEDDFPEIEASAVELQDYVRAVVADR
                     SRRISDDFLSCYLKAVREEGTLSPIEEIMQLVFLILAGSDATRNAMVMLPTLLLQNPV
                     VWSSLCHDQSGVAAAVEEGLRFEPSVGSFPRLALEDIDLDGYVLPKGSFLALSIMSGL
                     RDERHYEHPQLFDIKRKQMRRHLGFGAGVHRCLGEALARIELQEGLRTLLRRAPSLRV
                     TGDWPRMIGHGGARRATGMTVNLGVDR"
     gene            169219..170394
                     /locus_tag="ATU_RS23740"
                     /old_locus_tag="AGR_pTi_273"
                     /old_locus_tag="Atu6151"
     CDS             169219..170394
                     /locus_tag="ATU_RS23740"
                     /old_locus_tag="AGR_pTi_273"
                     /old_locus_tag="Atu6151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019963851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_010974909.1"
                     /translation="MQLAPVDRVTTIDDLTLDPYPIYRRMRAQTPVVRVASVMRTFLT
                     KASDTKMVKDQPRRFSSDDPNTPMKPAFQAHTLMRKDGAEHARERMAMAKAFAPKTTA
                     EHWAAIYRDIVNEYLDRLSRGSTVDLFAEICGPVAARILAHILGISEASDAEMIRWSQ
                     RLIEGAGNFGWRPEPFERANEANAEMNRLFDNLVEKHRAEPNPSAFAIMVTASDPIPM
                     SQIYANIKIAVGGGINEPRDALGTIIYGLLTNPEQFEEVKRQQCWGQVFEEGVRWVAP
                     IQASSRLVLEDTEIRGFLVPKGDTVMTIQASANRDEDVFDDGERFNVFRQNNAHQSFG
                     SGPHHCAGAQISRQTVGAIMLPTLFERFPNMTLTNPDAVQWRGFGFRGPISLPVTLI"
     gene            170670..171778
                     /locus_tag="ATU_RS23745"
                     /old_locus_tag="Atu6152"
                     /pseudo
     CDS             170670..171778
                     /locus_tag="ATU_RS23745"
                     /old_locus_tag="Atu6152"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015241702.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
     gene            172489..173427
                     /locus_tag="ATU_RS23750"
                     /old_locus_tag="AGR_pTi_277"
                     /old_locus_tag="Atu6154"
     CDS             172489..173427
                     /locus_tag="ATU_RS23750"
                     /old_locus_tag="AGR_pTi_277"
                     /old_locus_tag="Atu6154"
                     /function="involved in virulence"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010891511.1"
                     /translation="MEPSQRSLSDESEASRTEVHSTSTNRDMPPELLAKVATYIPTQD
                     PVETARNLGSLERTGRAGREAVTSDPVGKYHARMKRIGASAKTVFDTVIPGNQLPEWE
                     TNRPSPTARTRAVGPILKFQSEAGKSRFVTNILNLPESAQCDAILSVIKHLNDLGEAN
                     KTRLIERSIEILRLEPPLTWNMGQKCPAVDVLVQGEKYLNADQLARIQQERSSRPRLS
                     PLFGRAIADFEVQKTMDANPRRYRDAAGPEVRAVDTVIETIERYSASLARGGPNAVGL
                     LTTNESFEKNINEVYNRTRAELDASSRDRSRSGLSR"
     gene            174328..174762
                     /locus_tag="ATU_RS23755"
                     /old_locus_tag="Atu6156"
     CDS             174328..174762
                     /locus_tag="ATU_RS23755"
                     /old_locus_tag="Atu6156"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006204705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VirK family protein"
                     /protein_id="WP_010891509.1"
                     /translation="MKLMLPTLFGILLATAANAANDSHVLATFPEIALALTTGKPVDV
                     MVDLSLCTPGTDDTPPTKTRGGIRIDGYRITSDGTLAFADQHFTIDRDGKPILQFLRY
                     QIRLDGDAELTMVVFNMPSYERKGTSLAYKCAISHGLSFFAP"
     gene            complement(174859..>175610)
                     /locus_tag="ATU_RS23760"
                     /pseudo
     CDS             complement(174859..>175610)
                     /locus_tag="ATU_RS23760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018855502.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing N-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="HipA domain-containing protein"
     gene            176062..>176235
                     /locus_tag="ATU_RS23765"
                     /old_locus_tag="Atu6160"
                     /pseudo
     CDS             176062..>176235
                     /locus_tag="ATU_RS23765"
                     /old_locus_tag="Atu6160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004121997.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(177407..178117)
                     /locus_tag="ATU_RS23770"
                     /old_locus_tag="AGR_pTi_287"
                     /old_locus_tag="Atu6162"
     CDS             complement(177407..178117)
                     /locus_tag="ATU_RS23770"
                     /old_locus_tag="AGR_pTi_287"
                     /old_locus_tag="Atu6162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003581532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010974912.1"
                     /translation="MSLCPSKCFRIAALAAASIVLGTQIAIAQEPSIGSQWLNTPASR
                     VEALAVLQTLNANLLSNASATLTLDRWCAGHKLAPEGSKILAQRVRGQAKPADDHIRE
                     LLTVGPDEPIAYRRVRLVCGDRVLSEADNWYVPARLTAEMNQALNTSDIAFGRAVQAL
                     NFTRTNLSAKLLWSPLSEGWDMDGLIASGRGSPTLPPFLLEHRAVLKLPDGTPFSTLV
                     ESYTSKVLDFPVPRSLAQ"
     gene            complement(178580..178822)
                     /locus_tag="ATU_RS23775"
     CDS             complement(178580..178822)
                     /locus_tag="ATU_RS23775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017968945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_045023278.1"
                     /translation="MGHQKKSDKRLGYSHLRLATIDGVSLPDLQLSPDRQQRPTSTKR
                     SFFEQLLLDFAFGCELFYPIQLYEHLATREGEDQER"
     gene            complement(179262..179993)
                     /locus_tag="ATU_RS23780"
                     /old_locus_tag="AGR_pTi_290"
                     /old_locus_tag="Atu6164"
     CDS             complement(179262..179993)
                     /locus_tag="ATU_RS23780"
                     /old_locus_tag="AGR_pTi_290"
                     /old_locus_tag="Atu6164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(dimethylallyl)adenosine tRNA
                     methylthiotransferase"
                     /protein_id="WP_010974913.1"
                     /translation="MLLHLIYGPTCSGKTDMAIQIAQETGWPVVALDRVQCCPQIATG
                     SGRPLESELQSTRRIYLDSRPLTEGILDAESAHRRLIFEVDWRKSEEGLILEGGSISL
                     LNCMAKSPFWRSGFQWHVKRLRLGDSDAFLTRAKQRVAEMFAIREDRPSLLEELAELW
                     NYPAARPILEDIDGYRCAIRFARKHDLAISQLPNIDAGRHVELIEAIANEYLEHALSQ
                     ERDFPQWPEDGAGQPVCPVTLTRIR"
     gene            180831..183332
                     /gene="virA"
                     /locus_tag="ATU_RS23785"
                     /old_locus_tag="AGR_pTi_2"
                     /old_locus_tag="Atu6166"
     CDS             180831..183332
                     /gene="virA"
                     /locus_tag="ATU_RS23785"
                     /old_locus_tag="AGR_pTi_2"
                     /old_locus_tag="Atu6166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system sensor kinase VirA"
                     /protein_id="WP_010974914.1"
                     /translation="MNGRYSPSRQDFKTGAKPWSILALVVAAMIFALMAITSWQDNET
                     NRAILTQLRAINIDSASLQRDVLRAEAGVVANYRPIISRLGALRKNLENLKRLFKQSH
                     LVIGNDFSQLLDKLKVSVDTTDAAVAAFGAQNVLLQDSLASFTRALSILPKMSSTDQT
                     VENSNELGSLMLRFVRQPSPALSLEISHELDMLQKASGGAEVPIRILAREGRVILSIL
                     PRVNDAVNMIQTSDTAEIAERLERKCLEAYSLQSVREQRARIFLGSVSVGLCIYIISL
                     VYRLRRKTAWLTRRLDYEEVIKEIGVCFEGGGATASSLNSSAQAALGIIQRFFNAESC
                     ALALVDHGDRWAVESFAAKLPEPVWEDLALREMVSLARADERASVFRIMSTRKVSCLP
                     PETPGVSMLLAHKSTDQLIAICSLGYQGYRLKSCPGEVQLLELATACLCHYIDVRRKQ
                     TECDILERRLEHAERLQAVGTLAGGIAHEFNNILGAILGYAEMAQNMLRRSSVTRRHI
                     DQIISSGDRARLIIDQILTLSRKLERVTKPFSVSELVMEIAPLLRVALQRNIELKFKF
                     DDKKSVVEGSPLEVQQMLMNLCKNASQAFTADGQIDIIVSRIFVSRQKVLAHGVMPAG
                     DYVLLSVSDDGEGIAETVLPHIFEPFFTTRSCSGGTGLGLAAVHGHVSALAGYIDVTS
                     AVGRGTRFDIYLPPSSKKPVSPDAFFGPCKTPRGNGEIVALIEPDPVLREVYEDKIAA
                     LGYEPVGFKTCADLCNWISKGKQADLVLVDQSSLPENQSATALHAAFKTASIIIGGSD
                     LKMSLSSDDMTSALFLPKPISSRTMAYAIRTKIKA"
     gene            183877..184614
                     /locus_tag="ATU_RS23790"
                     /old_locus_tag="AGR_pTi_3"
                     /old_locus_tag="Atu6167"
     CDS             183877..184614
                     /locus_tag="ATU_RS23790"
                     /old_locus_tag="AGR_pTi_3"
                     /old_locus_tag="Atu6167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system lytic transglycosylase
                     VirB1"
                     /protein_id="WP_010974915.1"
                     /translation="MLKATGPLSIILLASTCPSSGAAPLSFAEFNNFARECAPSVAPS
                     TLAAIAQVESRFDPLAVHDNTTGETLHWQNQAQATQVVMDRLEARHSLDVGLMQINSR
                     NFSVLGLTPDGALQPCTSLSVAANLLGSRYAGGNTADDEQLSLRRAISAYNTGDFTHG
                     FANGYVRKVETAAQQLVPPLTARPKDDREKPGSEETWDVWGAYKRRSPEGGAGGSSGP
                     PPPPDEDNRKSEDDDQLLFDLNQGGPQ"
     gene            184614..184979
                     /locus_tag="ATU_RS23795"
                     /old_locus_tag="AGR_pTi_4"
                     /old_locus_tag="Atu6168"
     CDS             184614..184979
                     /locus_tag="ATU_RS23795"
                     /old_locus_tag="AGR_pTi_4"
                     /old_locus_tag="Atu6168"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilin major subunit VirB2"
                     /protein_id="WP_010891502.1"
                     /translation="MRCFERYRVHLNRLSLSNAVMRMVSGYAPSVVGAMGWSIFSSGP
                     AAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLGIVAIGISWMFGRASLGLVAGVVG
                     GIVIMFGASFLGKTLTGGG"
     gene            184979..185305
                     /locus_tag="ATU_RS23800"
                     /old_locus_tag="AGR_pTi_bx137"
                     /old_locus_tag="Atu6169"
     CDS             184979..185305
                     /locus_tag="ATU_RS23800"
                     /old_locus_tag="AGR_pTi_bx137"
                     /old_locus_tag="Atu6169"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB3"
                     /protein_id="WP_010891501.1"
                     /translation="MNDRLEEATLYLAATRPALFLGVPLTLAGLLVMFAGFVIVIVQN
                     PLYEVVLVPLWFGARLVVERDYNAASVVLLFLQTAGRSVDGLIWGGASVSPNPIKVPA
                     RGRGMA"
     gene            185305..187674
                     /gene="virB4"
                     /locus_tag="ATU_RS23805"
                     /old_locus_tag="AGR_pTi_8"
                     /old_locus_tag="Atu6170"
     CDS             185305..187674
                     /gene="virB4"
                     /locus_tag="ATU_RS23805"
                     /old_locus_tag="AGR_pTi_8"
                     /old_locus_tag="Atu6170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion/conjugal transfer ATPase
                     VirB4"
                     /protein_id="WP_010974916.1"
                     /translation="MLGASGTTERSGEVYLPYVGHVSDHIVLLEDGSIMTMAHVSGMA
                     FELEDAEMRNARCRAFNTLLRNIADDHVSIYAHLVRHDDVPPSPARHFRSAFSASLSE
                     AFEERVLSGKLLRNDHFLTLIVSPRAALGKVRRRFTKRYRQKENDLTAQTRNLEDLWH
                     LVAGALEAYGLRRLGIREKQDVLFTEVGEALRLIMTGRFTPVPVVSGSLGASIYTDRV
                     ICGKRGLEIRTPKDSYVGSIYSFREYPATTRPGMLNVLLSLDFPLVLTQSFSFLTRSQ
                     AHSKLSLKSSQMLSSGDKAVTQISKLSEAEDALASNEFVLGAHHVSLCIYANDLNNLA
                     DRGARARTRLADAGAVVVQEGIGMEAAYWSQLPGNYKWRTRPGAITSRNFAGLVSFEN
                     FPEGSGSGHWGNAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMTFILAML
                     EQSMVDRAGAVVLFDKDRGSELLVRATGGTYLALRRGAPSGLAPLRGLENTAASHDFL
                     REWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPHMRSIAGLREFLLHGPAEGAGA
                     RLQRWCRGNALGWAFDGELDEVKLDPSITGFDMTHLLEYEEVCAAAAAYLLHRIGAMV
                     DGRRFVMSCDEFRAYLLNPKFAAVVDKFLLTVRKNNGMLILATQQPEHVLESQLGASL
                     VAQCMTKIFYPSPTADRSAYIDGLKCTEKEFQAIREDMAVGSRKFLLKRESGSVVCEF
                     DLREMREYVAVLSGRANTVRFADQLRKVQGDNPSAWLSEFMARYHEAKD"
     gene            187691..188353
                     /locus_tag="ATU_RS23810"
                     /old_locus_tag="AGR_pTi_9"
                     /old_locus_tag="Atu6171"
     CDS             187691..188353
                     /locus_tag="ATU_RS23810"
                     /old_locus_tag="AGR_pTi_9"
                     /old_locus_tag="Atu6171"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013533340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilin minor subunit VirB5"
                     /protein_id="WP_010891499.1"
                     /translation="MKIMQLVAAAMAVSLLSVGPARAQFVVSDPATEAETLATALETA
                     ANLEQTITMVAMLTSAYGVTGLLTSLNQKNQYPSTRDLDTEMFSPRMPMSTTARAITT
                     DTDRAVVGGDAEADLLRSQITGSANSAGIAADNLETMDKRLTANAETSTQLSRSRNIM
                     QATVTNGLLLKQIHDAMIQNVQATSLLTMTTAQAGLHEAEEAAAQRKEHQKTAVIFGA
                     VP"
     gene            188454..189341
                     /locus_tag="ATU_RS23815"
                     /old_locus_tag="AGR_pTi_10"
                     /old_locus_tag="Atu6172"
     CDS             188454..189341
                     /locus_tag="ATU_RS23815"
                     /old_locus_tag="AGR_pTi_10"
                     /old_locus_tag="Atu6172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003537089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein"
                     /protein_id="WP_010974917.1"
                     /translation="MNFTIPAPFTAIHTIFDLAFTTSLDTMLGTIQEAVSAPLVACVT
                     LWIIVQGILVMRGEIDTRGGITRVITVTVVVALVVGQANYHDYVVSVFEETIPNFIQQ
                     FSGSGLPLQTIPAQLDTMFALTQAAFQRIASEIGPMNDQDILAFQGAQWVFYGTLWSA
                     FGIYDAVGILTKVLLAIGPLILTGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIV
                     ILTEATALTLMLGVITLAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGSYWS
                     GATQSANSLYRRFAQVDRR"
     gene            189377..189544
                     /locus_tag="ATU_RS23820"
                     /old_locus_tag="AGR_pTi_missing"
                     /old_locus_tag="Atu6173"
     CDS             189377..189544
                     /locus_tag="ATU_RS23820"
                     /old_locus_tag="AGR_pTi_missing"
                     /old_locus_tag="Atu6173"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system lipoprotein VirB7"
                     /protein_id="WP_010891497.1"
                     /translation="MKYCLLCLALALGGCQTNDKLASCKGPIFPLNVGRWQPTPSDLQ
                     LSNVGGRHEGV"
     gene            189531..190244
                     /locus_tag="ATU_RS23825"
                     /old_locus_tag="AGR_pTi_11"
                     /old_locus_tag="Atu6174"
     CDS             189531..190244
                     /locus_tag="ATU_RS23825"
                     /old_locus_tag="AGR_pTi_11"
                     /old_locus_tag="Atu6174"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019856525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB8"
                     /protein_id="WP_010891496.1"
                     /translation="MKGSEYALLVARETLAEHYKEVEAFQTARAKSARRLSKVIAAVA
                     TIAVLGNVAQAFTIATMVPLIRLVPVYLWIRPDGTVDSEVSVSRLPATQEEAVVNASL
                     WEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFFNYPNPTSPQVILGKHGRLEV
                     EHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLRLTNPGGLV
                     VTSYQTSEDTVSNAGHSEP"
     gene            190241..191122
                     /gene="virB9"
                     /locus_tag="ATU_RS23830"
                     /old_locus_tag="AGR_pTi_12"
                     /old_locus_tag="Atu6175"
     CDS             190241..191122
                     /gene="virB9"
                     /locus_tag="ATU_RS23830"
                     /old_locus_tag="AGR_pTi_12"
                     /old_locus_tag="Atu6175"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type conjugative transfer protein VirB9"
                     /protein_id="WP_010891495.1"
                     /translation="MTKKAFLTLACLLFAAIGARAEDTPTAGRLDPRMRYLAYNPDQV
                     VRLSTAVGATLVVTFGANETVTAVAVSNSKDLAALPRGNYLFFKASKVLPPQPVVVLT
                     ASDAGMRRYVFSISSKTLPHLDKEQADLYYSVQFAYPADDAAARQKAAQEKAVADRIR
                     AEAQYQQRAEGLLEQPATTVGAEDKNWHYVAQGDRSLLPLEVFDDGFTTVFHFPGNVR
                     IPSIYTINPDGKEAVANYSVKGSYVEISSVSRGWRLRDGHTVLCIWNTAYDPVGRRPE
                     TGTVRPDVKRVLKEVRG"
     gene            191119..192252
                     /gene="virB10"
                     /locus_tag="ATU_RS23835"
                     /old_locus_tag="AGR_pTi_13"
                     /old_locus_tag="Atu6176"
     CDS             191119..192252
                     /gene="virB10"
                     /locus_tag="ATU_RS23835"
                     /old_locus_tag="AGR_pTi_13"
                     /old_locus_tag="Atu6176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB10"
                     /protein_id="WP_010891494.1"
                     /translation="MNDDNQQSAHDVDASGSLVSDTHHRRLSGAQKLIVGGVVLALSL
                     SLIWLGGREKKENGDAPPSTMIATNTKPFHPAPIDVTLDPPAAQEAVQPTAPPPARSE
                     PERHEPRPEETPIFAYTSGDQGTSKRVQQGETDRRREGNGEDSPLPKVEVSAENDLSI
                     RMKPTELQPTRATLLPHPDFMVTEGTIIPCILQTAIDTSLAGYVKCVLPWDVRGTTNN
                     VVLLDRGTTVVGEIQRGLQQGDARVFVLWDRAETPDHAMISLASPSADELGRSGLPGT
                     VDNHFWQRFSGAMLLSVVQGAFQAASTYAGSSGGGTSFNSVQNNGEQTADTALKATIN
                     IPPTLKKNQGDTVSIFVARDLDFSGIYQLRMAGRAARGRDRRP"
     gene            192287..193327
                     /gene="virB11"
                     /locus_tag="ATU_RS23840"
                     /old_locus_tag="AGR_pTi_14"
                     /old_locus_tag="Atu6177"
     CDS             192287..193327
                     /gene="virB11"
                     /locus_tag="ATU_RS23840"
                     /old_locus_tag="AGR_pTi_14"
                     /old_locus_tag="Atu6177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013533334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type DNA transfer ATPase VirB11"
                     /protein_id="WP_046033762.1"
                     /translation="MQMEVDPQLRILLKPILEWLDDPRTEEVAINRPGEAFVRQAGAF
                     LKFPLPVSYDDLEDIAILAGALRKQDVGPRNPLCATELPDGERLQICLPPTVPSGTVS
                     LTIRRPSSRVSSLKEVSSRYDAPRWNQWKERKKRHDQHDEAILRYYDNGDLEAFLHAC
                     VVGRLTMLLCGPTGSGKTTMSKTLINAIPPQERLITIEDTLELVIPHENHVRLLYSKN
                     GAGLGAVTAEHLLQASLRMRPDRILLGEIRDDAAWAYLSEVVSGHPGSISTIHGANPV
                     QGFKKLFSLVKSSAQGASLEDRTLIDMLATAVDVIVPFRAHGDIYEVGEIWLAADARR
                     RGETIGDLLNQQ"
     gene            193546..194307
                     /gene="virG"
                     /locus_tag="ATU_RS23845"
                     /old_locus_tag="AGR_pTi_15"
                     /old_locus_tag="Atu6178"
     CDS             193546..194307
                     /gene="virG"
                     /locus_tag="ATU_RS23845"
                     /old_locus_tag="AGR_pTi_15"
                     /old_locus_tag="Atu6178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator VirG"
                     /protein_id="WP_010891492.1"
                     /translation="MAGQDPRLRGEPLKHVLVIDDDVAMRHLIVEYLTIHAFKVTAVA
                     DSKQFNRVLCSETVDVVVVDLNLGREDGLEIVRSLATKSDVPIIIISGARLEEADKVI
                     ALELGATDFIAKPFGTREFLARIRVALRVRPSVARTKDRRSFSFADWTLNLRRRRLIS
                     EEGSEVKLTAGEFNLLVAFLEKPRDVLSREQLLIASRVREEEVYDRSIDVLILRLRRK
                     LEGDPTTPQLIKTARGAGYFFDADVDVSYGGVMAA"
     gene            complement(194449..195057)
                     /locus_tag="ATU_RS23850"
                     /old_locus_tag="AGR_pTi_16"
                     /old_locus_tag="Atu6179"
     CDS             complement(194449..195057)
                     /locus_tag="ATU_RS23850"
                     /old_locus_tag="AGR_pTi_16"
                     /old_locus_tag="Atu6179"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein VirC2"
                     /protein_id="WP_010891491.1"
                     /translation="MGIRKPALSVGEARRLAAARPEIVHPSLPVATQNSTLPQPPENL
                     DEEDRRPAPATAKRCHSSDQQSMLTVDALSSTTAPEKIQVFLSARPPAPEVSKIYDNL
                     ILQYSPSKSLQMILRRALGDFENMLADGSFRAAPKSYPIPHTAFEKSIIVQTSRMFPV
                     SLIEAARNHFDPLGLETARAFGHKLATAALACFFAREKATNS"
     gene            complement(195060..195755)
                     /locus_tag="ATU_RS23855"
                     /old_locus_tag="AGR_pTi_18"
                     /old_locus_tag="Atu6180"
     CDS             complement(195060..195755)
                     /locus_tag="ATU_RS23855"
                     /old_locus_tag="AGR_pTi_18"
                     /old_locus_tag="Atu6180"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011427359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer ATPase VirC1"
                     /protein_id="WP_010891490.1"
                     /translation="MKLLTFCSFKGGAGKTTALMGLCAAFASDGKRLALFDADENRPL
                     TRWKENALRSNTWGSFCEVYAAEEMALLEAAYEDAELQGFDYALADTHGGSSELNNTI
                     IASSNLLLIPTMLTPLDIDEALSTYRYVIELLLSENLAIPTAVLRQRVPVGRLTTSQR
                     AMSDMLASLPVVQSPMHERDAFAAMKERGMLHLTLLNMRTDPTMRLLERNLRIAMEEL
                     VTISKLVSEALEG"
     gene            196026..196469
                     /gene="virD1"
                     /locus_tag="ATU_RS23860"
                     /old_locus_tag="AGR_pTi_19"
                     /old_locus_tag="Atu6181"
     CDS             196026..196469
                     /gene="virD1"
                     /locus_tag="ATU_RS23860"
                     /old_locus_tag="AGR_pTi_19"
                     /old_locus_tag="Atu6181"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T-DNA border endonuclease subunit VirD1"
                     /protein_id="WP_010891489.1"
                     /translation="MSQGSRPTSSDIAVNQRECVKVEGFKVVSTRLRSAEYESFSHQA
                     RLLGLSDSMAIRVAVRRIGGFLEIDAETRHRMEAILQSIGTLSSNIAALLSAYAENPT
                     MDLEALRAERIAFGKSFADLDGLLRSILSVSRRRIDGCSLLKDAL"
     gene            196503..197846
                     /locus_tag="ATU_RS23865"
                     /old_locus_tag="AGR_pTi_21"
                     /old_locus_tag="Atu6182"
     CDS             196503..197846
                     /locus_tag="ATU_RS23865"
                     /old_locus_tag="AGR_pTi_21"
                     /old_locus_tag="Atu6182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T-DNA border endonuclease VirD2"
                     /protein_id="WP_010974919.1"
                     /translation="MPDRAQVIIRIVPGGGTKTLQQIINQLEYLSRKGRLELQRSARH
                     LDIPLPPDQIHELARSWVQETGTYDESQPDEERQQELTTHIIVSFPAGTSQVAAYAAS
                     REWAAEMFGSGAGGGRYNYLTAFHIDRDHPHLHVVVNRRELLGHGWLKISRRHPQLNY
                     DALRIKMAEISLRHGIALDASRRAERGITERPITYAQYRRLEREQARQIRFEDADLEQ
                     SSPQGDHPEFSQPFDTSPFEASAGGPEDMPRPNNRQNESQVHLQEPAGVSNEAGVLVR
                     VALETERLAQPFVSETILADDIGSGSSRVAEGRVESANRTPDIPRAATEAATHTTHDR
                     QRRAKRPHDDDGGPSGAKRVTLEGIAVGPQANAGEQDGSSGPLVRQAGTSRPSPPTAT
                     TRASTATDSLSATAHLQQRRGVLSKRPREDDDGEPSERKRERDERSKDGRGGNRR"
     gene            197861..199882
                     /locus_tag="ATU_RS23870"
                     /old_locus_tag="AGR_pTi_22"
                     /old_locus_tag="Atu6183"
     CDS             197861..199882
                     /locus_tag="ATU_RS23870"
                     /old_locus_tag="AGR_pTi_22"
                     /old_locus_tag="Atu6183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein virD3"
                     /protein_id="WP_010974778.1"
                     /translation="MANEEFTRHYAWPVPVASNDEGRGTARIPIQAQSIVAGEDGRDT
                     SVPTALSRPPIEDMPHGVQETSASGGRLGAARLRDSVIPPGISEARTDLSAILRKKSG
                     SFRTGMQYLRGLERENFDKQDREASALPDLSARGIKRPREIEYPGNASGLTIKRQDGL
                     GIEINTISASSPVNRAAHSSNWQGAPEPGVYNVQPSADRAQNSAQESSTFPDGTSVSA
                     LYSGPLAEWFERDTGSETTRNSGNTISSPLRGLEEFGDSADSRYLGREAQSLSVTVTT
                     PNSNAEASSHSAHTETLDDVSSDRSSEQGRGPLGAAILGSHHDLSPRAQKLSQTNRDS
                     PELTDADLAKVDAVFESLSKGPPAGESAAPDFRERGPGSAFQKEGVSDRANGVPTNWE
                     VPFGRGGGHSPQALRSSGVELDDFPDFTEAELAKIDALVESHSNRSLSVRNIVPDLRG
                     AGADNVFRKEGVVERAEKMPIDSVSLTRLNGERSRSPKTSQASLEDFPDLTDADLAHI
                     EESERIARTAVEKGKQKISTEADTRFDLGNSSAPRVSPRSVTPLVPNANQPITSWFYE
                     AQKTCDKLVENTYVKPAVDSSRARNDVENTAARLGDPAPALGHDNLGRTRALTPVRDV
                     MSRPSADRQLASHAAEHSAIDDIWKRDDRDRRTHPYRGLDSRSREGCGR"
     gene            199956..201962
                     /gene="virD4"
                     /locus_tag="ATU_RS23875"
                     /old_locus_tag="AGR_pTi_23"
                     /old_locus_tag="Atu6184"
     CDS             199956..201962
                     /gene="virD4"
                     /locus_tag="ATU_RS23875"
                     /old_locus_tag="AGR_pTi_23"
                     /old_locus_tag="Atu6184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974920.1"
                     /note="The ATPase VirD4 is a core component of the
                     VirB/VirD4 form of type IV secretion systems (T4SS), also
                     known as type IVa secretion systems; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system ATPase VirD4"
                     /protein_id="WP_010974920.1"
                     /translation="MNSSKTTPQRLAVSIVCSLAAGFCAASLYVTFRHGFNGEAMMTF
                     SVFAFWYETPLYMGHATPVFYCGLAIVVSTSIVVLLSQLIISFRNHEHHGTARWAGFG
                     EMRHAGYLQRYNRIKGPIFGKTCGPRWFGSYLTNGEQPHSLVVAPTRAGKGVGVVIPT
                     LLTFKGSVIALDVKGELFELTSRARKAGGDAVFKFSPLDPERRTHCYNPVLDIAALPP
                     ERQFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQP
                     GEKYKLFAHLAEESRNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAAT
                     SRSDFSVYDLRRKRTCVYLCVSPNDLEVVAPLMRLLFQQVVSILQRSLPGKDERHEVL
                     FLLDEFKHLGKLEAIETAITTIAGYKGRFMFIIQSLSALTGIYDDAGKQNFLSNTGVQ
                     VFMATADDETPTYISKAIGDYTFKARSTSYSQARMFDHNIQISDQGAPLLRPEQVRLL
                     DDNNEIVLIKGHPPLKLRKVRYYSDRMLRRLFECQIGALPEPASLMLSEGVHRDGQDL
                     SQQAAVTEAQGLGDIDSIPNNMEAATPQNSEMDDEQDSLPTGIDVPQGLIESDEVKED
                     AGGVVPDFGVSAEMAPAMIAQQQLLEQIIALQQRYGPASSHSVK"
     gene            202074..204596
                     /locus_tag="ATU_RS23880"
                     /old_locus_tag="AGR_pTi_24"
                     /old_locus_tag="Atu6185"
     CDS             202074..204596
                     /locus_tag="ATU_RS23880"
                     /old_locus_tag="AGR_pTi_24"
                     /old_locus_tag="Atu6185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012649017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virA/G regulated protein"
                     /protein_id="WP_010974921.1"
                     /translation="MRPSGNPNVDLSGSTASLAEVPAGATPVLNLIEPRNRPADDSLE
                     GQTDRGEHPSASFDYDGMKLGAAEREAYENWCPSNRPTWKDLVLRARLDAIDSSAWLP
                     DLGEESPLIFRYEGIPLGEGERQAYKEWQEEAQPTWEDLVVNARMAVPDPCADVADEH
                     NPLKEGEEFRSEASKRKRKKPIDQDENSPTSFYYDGMRLGEPEREAYDNWGNAEPPTW
                     KDLVLKARLDAIDSSAWLFASEGSSSTFEYEGIPLGEGERQAYKEWQEDAQPTWEDLV
                     INARMAELDHPSWITDEHNSLEENLEFRPDARQASLKDSTDQRKSSSASFIYDGMKLG
                     EPEHAAYENWSKPERPSWEALILDARQASIASSSVSNSLLAKTSSPVFLYEGMSLGDA
                     ERQSYGRWRQPAQPRWQNLVVNARLADLDPLAWIPDEHDPFAEAEALSPTSQSSGANK
                     SNRALGQSDSGRPAFAYLAAQEASHLQSPACSQLETRRALNFGSPGPDANPTESIAKC
                     NRLDGVSKIKRLGTKGRRAVNATIHGGKFGAQGLLSEDCGQAAEPSPSEQTTRPRTDN
                     IGTYASRKNERARLATETGKYESEHIFGFKVVHDTLRATKEGRRLERPMPAYLEYKEL
                     HRQHVGTGRGRTGLVGRGWPDDASYRADQRATLSDPVASAEGATASNGYQLNQLGYAH
                     QLATHGLQSETPDGVTMPIQVATISYNYTVSRDPVLSPPSKEQAPPLLHLGPRGQTEA
                     VLARETALTGKWPTLERECQVYQRFLALYDVKKDLDAKQLGVRQKKQALVAALNRTAG
                     LIGASPLEAQSSTAEVEYTTDEPDERRVYDPRDRGRDKAFNR"
     gene            204774..205232
                     /locus_tag="ATU_RS23885"
                     /old_locus_tag="Atu6186"
     CDS             204774..205232
                     /locus_tag="ATU_RS23885"
                     /old_locus_tag="Atu6186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virA/G regulated protein"
                     /protein_id="WP_162993138.1"
                     /translation="MVDFSRGRATSLSKDEVLAGPPWVSRKILGVTVGKELKTLSKRE
                     LDVQRLRAAERALDKQVWQNPPVNPSRSQRGDANSHLRNERDERLESEMTIAHQAASV
                     SVGEDRQALDAARSTLNELHNSPSSDDRANLSLPRAEICDRTTYPPSPSH"
     gene            205684..205935
                     /gene="virE3"
                     /locus_tag="ATU_RS23890"
                     /old_locus_tag="AGR_pTi_25"
                     /old_locus_tag="Atu6188"
     CDS             205684..205935
                     /gene="virE3"
                     /locus_tag="ATU_RS23890"
                     /old_locus_tag="AGR_pTi_25"
                     /old_locus_tag="Atu6188"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VirE locus virulence protein VirE3"
                     /protein_id="WP_010974776.1"
                     /translation="MHGDDVDRTAFVPRRLPAEAAYVDSQVDLAANRQPHCVTCFERL
                     LVQEKDENRRRLWASGKACATSEESCAGGPTLAPGHSGP"
     gene            206051..206242
                     /locus_tag="ATU_RS23895"
                     /old_locus_tag="AGR_pTi_26"
                     /old_locus_tag="Atu6189"
     CDS             206051..206242
                     /locus_tag="ATU_RS23895"
                     /old_locus_tag="AGR_pTi_26"
                     /old_locus_tag="Atu6189"
                     /function="involved in virulence"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010891482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system effector chaperone
                     VirE1"
                     /protein_id="WP_010891482.1"
                     /translation="MVIIKLNANKNMPVLAVEKPQEIHKEELSDHHQSNGFTSLDLEM
                     IELENFVLHCPLPEENLAG"
     gene            206256..207926
                     /locus_tag="ATU_RS23900"
                     /old_locus_tag="AGR_pTi_28"
                     /old_locus_tag="Atu6190"
     CDS             206256..207926
                     /locus_tag="ATU_RS23900"
                     /old_locus_tag="AGR_pTi_28"
                     /old_locus_tag="Atu6190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system single-stranded DNA
                     binding effector VirE2"
                     /protein_id="WP_010974922.1"
                     /translation="MDPKAEGNGENITETAAGNVETSDFVNLKRQKREGVNSTGMSEI
                     DMTGSQETPEHNMHGSPTHTDDLGPRLDADMLDSQSSHVSSSAQGNRSEVENELSNLF
                     AKMALPGHDRRTDEYILVRQTGQDKFAGTTKCNLDHLPTKAEFNASCRLYRDGVGNYY
                     PPPLAFERIDIPEQLAAQLHNLEPREQSKQCFQYKLEVWNRAHAEMGITGTDIFYQTD
                     KNIKLDRNYKLRPEDRYIQTEKYGRREIQKRYEHQFQAGSLLPDILIKTPQNDIHFSY
                     RFAGDAYANKRFEEFERAIKTKYGSDTEIKLKSKSGIMHDSKYLESWERGSADIRFAE
                     FAGENRAHNKQFPAATVNMGRQPDGQGGMTRDRHVSVDYLLQNLPNSPWTQALKEGKL
                     WDRVQVLARDGNRYMSPSRLEYSDPEHFTQLMDQVGLPVSMGRQSHANSVKFEQFDRQ
                     AAVIVADGPNLREVPDLSPEKLQQLSQKDVLIADRNEKGQRTGTYTNVVEYERLMMKL
                     PSDAAQLLAEPSDRYSRAFVRPEPALPPISDSRRTYESRPRGPTVNSL"
     gene            207993..210047
                     /locus_tag="ATU_RS23905"
                     /old_locus_tag="AGR_pTi_29"
                     /old_locus_tag="Atu6191"
     CDS             207993..210047
                     /locus_tag="ATU_RS23905"
                     /old_locus_tag="AGR_pTi_29"
                     /old_locus_tag="Atu6191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012649040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virA/G regulated protein"
                     /protein_id="WP_010974923.1"
                     /translation="MVDTTKKSVAKSLTADMRRSAKRLSKQMRKASLTEEEATRNLAR
                     LETPDQKRKYVADMQIIDKLEDGFRGEISYKMLGNKQLRVDSPKELTREHGIIRKTRK
                     VLKRNAETGNVYLGLHEKKTWRSVSSHLYAEDGTLRAKHVKYKDGRFEEKWERDENGL
                     LFRTQFVNRNRLFQPISEKVSTPYRSGPENRLFRELTRRKGSKQETFERDEKGNLELI
                     GSKRLGFSKNSTKAVDRQTSQTTIRKLGGAFSKSYRSLLDTEGNELGRDISSHRRLFN
                     KRSAVYDEASGQLTSTKHTFGKIYKSETAYLNADIKKVSKKILGVTVRRKLTTLSEQE
                     HDAQKLRNSESIEHRKAWQERAVIPRSPPRETANVDSAPQSHLVNSLRDGRRDEAEPR
                     VVPAKDRRLEGVIQNSPLFRQPNSERRVGSQTLPPSSNVRASDPVFPREGAKSEKGPV
                     AVNLQRDNEREKQEEKNLSERRGNLFRSSRSITETSFPGSPERITMLGSRRASINPSA
                     DPQSPVGRTDSQAPPMSLFPINNHQSDPNEQELLSFLHSVPVPPPLEVHGAPGGRVED
                     SLRGASGDSLVRTSSVSESVFDEHSQGPLERDHSTNATSERFDPQALFGEPGLSRVSE
                     TRPELSMQGDHLTNSEQQALLNELLSVPLPGPLPKADHERPRVLESSRSRERSMSGGL
                     SL"
     gene            210260..>210334
                     /locus_tag="ATU_RS23910"
                     /pseudo
     CDS             210260..>210334
                     /locus_tag="ATU_RS23910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012652096.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
     gene            210418..210806
                     /locus_tag="ATU_RS23915"
                     /pseudo
     CDS             210418..210806
                     /locus_tag="ATU_RS23915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007811349.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            210803..211060
                     /locus_tag="ATU_RS23920"
     CDS             210803..211060
                     /locus_tag="ATU_RS23920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011970376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family insertion sequence element accessory
                     protein TnpB"
                     /protein_id="WP_161974323.1"
                     /translation="MIFPSNRVRIMVATKPVDFRKGHDGLAALVKNELRKDAVIGRMR
                     IEGALFLRQPRPFLLPDHAKTCFLDLARLTTGSRASNFLSK"
     gene            complement(210868..211239)
                     /locus_tag="ATU_RS23925"
                     /old_locus_tag="AGR_pTi_32"
                     /old_locus_tag="Atu6192"
     CDS             complement(210868..211239)
                     /locus_tag="ATU_RS23925"
                     /old_locus_tag="AGR_pTi_32"
                     /old_locus_tag="Atu6192"
                     /inference="COORDINATES: protein motif:HMM:NF015437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer binding domain-containing protein"
                     /protein_id="WP_161974325.1"
                     /translation="MQHWLDKLTDLAAIEGDECILKTGLADFAEHFGFTGFAYLHIQH
                     KHIIAVTNYHREWQSTYFDKKFDALDPVVKRARSRKHVFAWSGSRNGRGCRRKSAPSM
                     RMRPITASLRSSFLTNAANPS"
     gene            complement(211215..211946)
                     /locus_tag="ATU_RS23930"
                     /old_locus_tag="AGR_pTi_34"
                     /old_locus_tag="Atu6193"
     CDS             complement(211215..211946)
                     /locus_tag="ATU_RS23930"
                     /old_locus_tag="AGR_pTi_34"
                     /old_locus_tag="Atu6193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate isomerase/epimerase"
                     /protein_id="WP_010974924.1"
                     /translation="MNNIIATGFNTASTDGELDSLERELRRLEAIGVDTVELALSSLD
                     LIAGGRIVKERGDRLRTLLETFSFRYTVHGLVSSNFMDPATRRHQVDAAKALVEICDS
                     IDARVLVQHAGFLRADQIAQRAGADERQCEALLELGEHAKAYGIRIAFENIFTTEPGQ
                     YRQTPAEVAATVKAVNHPDVVALIDFSHAYLESNYRGLDFRDQLRAMAPVLGAPGRRL
                     SRRTATTRIVVITDGGMECSTGWTS"
     gene            complement(211970..212497)
                     /locus_tag="ATU_RS23935"
                     /old_locus_tag="AGR_pTi_35"
                     /old_locus_tag="Atu6194"
     CDS             complement(211970..212497)
                     /locus_tag="ATU_RS23935"
                     /old_locus_tag="AGR_pTi_35"
                     /old_locus_tag="Atu6194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010974775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_010974775.1"
                     /translation="MPGEPAGQTALARLAMVADKLWTGEIRTQYAAICYRRTDDSSGP
                     IEVLLITSRGTGRWVIPKGWPMAKKKPHEVASQEAWEEAGVRGRVRKKAWGHYTYVKR
                     LGDGEFIPAMVQVHLLDVQRMEDDFPERHQRELQWFSPRLAASAVGEPELRGLFARLE
                     EREIQRAAAVASKAG"
     gene            complement(212701..213478)
                     /locus_tag="ATU_RS23940"
                     /old_locus_tag="AGR_pTi_37"
                     /old_locus_tag="Atu6196"
                     /pseudo
     CDS             complement(212701..213478)
                     /locus_tag="ATU_RS23940"
                     /old_locus_tag="AGR_pTi_37"
                     /old_locus_tag="Atu6196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654927.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
     gene            complement(213471..>213779)
                     /locus_tag="ATU_RS23945"
                     /old_locus_tag="AGR_pTi_38"
                     /old_locus_tag="Atu6197"
                     /pseudo
     CDS             complement(213471..>213779)
                     /locus_tag="ATU_RS23945"
                     /old_locus_tag="AGR_pTi_38"
                     /old_locus_tag="Atu6197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012654928.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
CONTIG      join(AE007871.2:1..214233)
//
DBGET integrated database retrieval system