KEGG   Rhizobium johnstonii: pRL70158
Entry
pRL70158          CDS       T00402                                 
Name
(GenBank) putative conjugative DNA transfer/component of type IV secretion system
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
rle  Rhizobium johnstonii
Pathway
rle03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    pRL70158
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rle02044]
    pRL70158
Enzymes [BR:rle01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     pRL70158
Secretion system [BR:rle02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   pRL70158
SSDB
Motif
Pfam: T2SSE nSTAND3 AAA_16 AAA_7 Zeta_toxin AAA_2 CPT FtsK_SpoIIIE Sigma54_activat AAA_28 DEAD Septin TsaE
Other DBs
NCBI-ProteinID: CAK11685
RhizoBase: pRL70158
UniProt: Q1M9N2
Position
pRL7:131317..132318
AA seq 333 aa
MNYVPKNREISYVEQYLSPLREFLVDDRVNELVINPNGSIFIEAAGAEYMHEIDVPLSPH
AIKRLGAQLAGDTRNTLGALHPIVSGRVMVWGHPLRVQIVVEPAIEDGVSLSIRKYLTHA
LATKDIGFVNGGQIRVDAQRRRRHRAIAKMARDGDLQGLFRQAIEERFNVLVSGGTSSGK
TTIARSLISMMDHNERLITIEDAQELFPPHRNQVGLISDRKDKSARMPSKLLESCLRMRP
DRIIVGEVRGVEAYDFLEAINTGHPGAITTIHADSPALAFDRLALMVMRSGIRLTHGEVI
TYAKRTIDLVVQVGRLNGSRGVLEIYLPSQEEE
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaattatgttccgaagaatcgcgaaatctcctacgtggagcaatatctgagccctctg
agagagtttctggtcgatgaccgcgtcaacgagcttgtgatcaatccaaacggctcaatc
ttcatcgaagccgcgggtgccgaatacatgcacgagatcgacgtgccgctgtcgccccat
gccattaagcggctaggtgcgcagcttgccggcgacacccgcaacacacttggcgccttg
catccgattgtttccggccgggtcatggtctgggggcacccactgcgcgttcaaatcgtg
gtcgaaccagcgatcgaagacggcgtatcgttgtcgatccgcaaatacttaacacacgcg
ctggcgacgaaggatatcggcttcgtcaacggcggacagatacgagtcgatgcgcagcgc
cgccgccgacacagggcgattgctaagatggcgcgcgacggcgacctgcagggtctgttc
cggcaggcaatcgaggagaggttcaacgtgctggtatccggtggcacctcctcgggcaaa
acaacgatcgcgcgctcgctgatttccatgatggaccacaatgaacgcctgatcaccatt
gaggacgcacaggagctcttcccaccccatcgcaaccaagtggggttgatatccgaccgg
aaggacaagtccgcacggatgccttccaagctgcttgaaagctgcctgcgcatgcggccg
gatcgcatcatcgtcggagaagtccgcggcgtagaggcctatgactttctcgaagcaatc
aacaccggtcaccctggggccattactaccatccatgctgatagccccgcgctagcattt
gaccgccttgcgctaatggtgatgcgctcggggattagacttacccatggcgaggttatc
acgtatgctaagcgcacaatcgacttggtggttcaggtcggacggcttaatgggtcccgc
ggggtgcttgagatttacctcccttcacaagaggaggaatga

DBGET integrated database retrieval system