KEGG   Cupriavidus metallidurans: Rmet_2336
Entry
Rmet_2336         CDS       T00351                                 

Gene name
virD4
Definition
(GenBank) VirD4, Type IV secretory pathway, VirD4 components
Organism
rme  Cupriavidus metallidurans
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Other DBs
NCBI-ProteinID: ABF09213
UniProt: Q1LKW3
Position
2548986..2551175
AA seq 729 aa
MSGKQPVEVLLRPAVELYTVAACAGAAFLCLVAPWSLALSPAMGIGSALAFGAYGAIRYR
DARIILRYRRNIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYV
EPTPAYRLTRRLEERLEFAPLPLSRLPKLTGWDAPFNPVRPLPPVGGLPRLHGIEPDEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRRNAAGEHEVVIVIDPKGDADLLKR
MYVEAQRAGREGEFYIFHLGWPEISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREF
AWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAY
TQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGAT
DSSDIRGATDFTSNTQDRISMASVPMIEPSHVVGLPKGQCFALLQGGQLWKVRMPLPAPD
PDEVMPTDLQQLAGYMRQSYSEATQWWEFTSSAALPHAALPDDLLDDAAPAEPDAVATGA
DDSTGEAAP
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtcgggcaaacagccggtcgaggttctgctacgcccagcggtggagctatacaccgtc
gcggcgtgtgcaggcgccgcgtttctgtgcctggtggccccatggtcgctcgcgctgagc
ccggccatgggcatcggcagcgccttggcgttcggcgcctacggcgcgatccgctaccgc
gatgcccgcatcatcctgcgctaccggcgcaacatccgccgtctgccgcgttacgtgatg
accagcaaggacgtgccggtcagccagcagcgcctattcgtggggcgcggctttctctgg
gagcagaagcacacgcatcggctgatgcagacgtaccggcccgagttccgccgctacgtc
gagccgacgccggcctaccggctgaccaggcgcctggaggaacggctggagttcgcgcca
ttgccgctctcgcgcctgccgaagctcaccggctgggacgcgcctttcaaccccgtgcgc
ccgttgccgcctgtcggcggcctgccaaggctgcacggcatcgagcccgacgaagtggac
gtcagcctgccgctgggcgagcgcgtcgggcactcgctggtgctgggcaccacgcgggtg
ggcaagacgcgcctggccgagttgttcgtcacgcaggacatccgtcgcaggaatgctgcc
ggcgagcatgaggtcgtcatcgtcatcgaccccaagggggatgccgatctcttgaaacgg
atgtacgtcgaagcccagcgcgctggccgcgaaggcgagttctacatcttccacttgggc
tggccggaaatcagcgcccgctacaacgccgtgggccgcttcggtcggatctcggaagtg
gcgacacgcatcgcggggcagctctccggcgaaggcaacagcgcggcgttccgcgagttc
gcatggcgcttcgtgaacatcatcgcccgcgccctggtggaactggggcagcgcccggac
tacatgctgatccagcgccacgtcatcaacatcgacgcgctgttcattgagtacgcccag
cactactttgccaagacggagcccaaggcctgggaggtgatcgtccagatcgaggccaag
ctcaacgagaagaacatcccaaggaacatgatcgggcgcgagaagcgtgtggtggcgctg
gagcaatacctctcccaggcgcgcaactacgaccctgtgctcgatggcctgcgctcggcg
gtgcgctacgacaagacctacttcgacaagatcgttgcatcgctgctgccgctgctggaa
aagctcacgagcggcaagatcgcccagctcctggcgccgaactactccgacctggccgac
ccgcgcccgatcttcgactggatgcaggtgatcaggaagcgcgccgtcgtctatgtcggc
ttggacgcgctgtccgatgcggaggtcgccgcagcggtcggcaactcgatgttcagcgat
ctcgtctcggtggctgggcacatctacaagcacggaatcgacgatggcctgccgggcgca
tcggctggtgcgcgcgtgccgatcaacgtgcatgcggacgagttcaatgaattgatgggt
gacgagttcattccgctcatcaacaagggcggtggcgcgggcctgcaagtcaccgcctac
acgcaaacgctttcggacatcgaggcccgcatcggcaaccgcgcgaaggccggccaagtg
atcgggaatttcaacaatttattcatgttgcgcgtgcgcgagacggccaccgcggaactg
ctgacgaggcagttgccgaaggtcgaggtctatacgaccaccatcgtctcgggcgcgacg
gacagctcagacatccgcggcgcgacggacttcacgtcgaacacccaggaccgcatcagc
atggccagcgtgccgatgatcgagccgtcacacgtcgtcggtctgcccaagggccaatgc
ttcgcgctgctgcagggcggccagctttggaaggtgcgcatgccgcttccggcgccagac
cccgatgaagtgatgccgacggacttgcagcaactggccgggtatatgcgccagagctac
agcgaggccacgcagtggtgggagttcaccagttccgcagccttgccgcatgcagccttg
cccgacgacctgctggatgacgccgctccagccgagcctgacgcggtggccaccggcgcc
gacgacagcaccggcgaggccgcaccatga

DBGET integrated database retrieval system