KEGG   Ralstonia mannitolilytica: TK49_07955
Entry
TK49_07955        CDS       T03778                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14580  naphthalene 1,2-dioxygenase subunit beta [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
rmn  Ralstonia mannitolilytica
Pathway
rmn00624  Polycyclic aromatic hydrocarbon degradation
rmn00626  Naphthalene degradation
rmn00627  Aminobenzoate degradation
rmn00633  Nitrotoluene degradation
rmn00642  Ethylbenzene degradation
rmn01100  Metabolic pathways
rmn01120  Microbial metabolism in diverse environments
rmn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TK49_07955
   00633 Nitrotoluene degradation
    TK49_07955
   00642 Ethylbenzene degradation
    TK49_07955
   00626 Naphthalene degradation
    TK49_07955
   00624 Polycyclic aromatic hydrocarbon degradation
    TK49_07955
Enzymes [BR:rmn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     TK49_07955
    1.14.12.23  nitroarene dioxygenase
     TK49_07955
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     TK49_07955
SSDB
Motif
Pfam: Ring_hydroxyl_B ACP_PD
Other DBs
NCBI-ProteinID: AJW44647
Position
1:1666872..1667438
AA seq 188 aa
MTKDLSAHDAEEFHRFFVGHDSDLQQEVTTLLTREAHLLDIQAYKAWLEHCVAPEIKYQV
ISRELRSTSERRYQLNDAVNIYNENYQQLKVRVEHQMDPQNWANSPKIRFTRFVTNVTAA
KDKIVPDLLHVRSNLILHRARRGNQVDVFYATREDKWKRIEGGGIKLVERFVDYPERILQ
THNMMIFL
NT seq 567 nt   +upstreamnt  +downstreamnt
atgacgaaggacctctccgcgcacgacgccgaagaatttcatcgtttcttcgtcgggcac
gacagcgatctgcagcaagaagtcaccacactcctgacccgagaagcacatctgttggac
attcaggcctacaaagcctggcttgaacactgcgttgcccccgagatcaaataccaagtg
atctcgcgagaacttcgctccacttccgagcgtcgataccaactgaatgatgcggtgaac
atctacaacgagaactatcaacagctgaaagttcgagttgaacaccagatggacccgcag
aactgggccaacagcccgaagatccgtttcacccgcttcgtcaccaatgtcacagcggcc
aaggacaagatcgtaccggatctgctgcatgtgcgttccaacctcattctccaccgcgcc
agacgcggcaatcaagttgacgtcttctatgcaacgcgggaagacaaatggaaacgcatc
gaaggtggtggcatcaaattggtcgaacgctttgtggactacccggagcgcattctccaa
acccacaatatgatgatcttcctgtga

DBGET integrated database retrieval system