KEGG   Rattus norvegicus (rat): 100529260Help
Entry
100529260         CDS       T01003                                 

Gene name
Ankhd1
Definition
(RefSeq) ankyrin repeat and KH domain containing 1
  KO
K16726  ankyrin repeat domain-containing protein 17
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100529260 (Ankhd1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100529260 (Ankhd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 KH_1 MCLC
Motif
Other DBs
NCBI-GeneID: 100529260
NCBI-ProteinID: NP_001190982
RGD: 4892133
Ensembl: ENSRNOG00000030247
UniProt: E9PTK9 Q5XI12
Position
18p11
AA seq 2523 aa AA seqDB search
MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVRLFGEAGPAPGVGGGG
SAGGGDAALDFKLAAAVLRTGGGGGASGSDEDEVSEVESFILDQEDLDNPVLKTSEIFLS
STAEGADLRTVDPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAA
AALTRMRAESTHSTGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACS
AGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNSQSATGNT
ALTYACAGGFIDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGAGINTH
SNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDS
GAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMV
ALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGH
LELVKYLLAAGANVHATTATGDTALTYACENGHTDVADVLLQAGAHLEHESEGGRTPLMK
AARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHRLKD
GSTMLIEAAKGGHTNVVSYLLDYPNNVLSVPTTDVSQLTSPSQDESQVPRVPIHTLAMVV
PPQEPDRTSQETSTALLGVQKGASKQKSSSLQVADQDLLPPFHPYQPLECIVEETEGKLN
ELGQRISAIEKAQLKSLELIQGEPLNKDKIEELKKNREEQVQKKKKILKELQKVERQLQM
KTQQQFTKEYLETKGQRDAESPPQQCSHRGVFMAGEEDGSLPEDHSSESPQVDTVSFKDH
GIDKQQSPSSAEQINFVPVQPLSSPQSNFSGDLGSNGTNSLVLQKVSGNQQIVGQPQIAI
AGHEQGLLVQEPDGLMVATPAQTLTDTLDDLIAAVSTRVPVGSNNPSQTTECPTPESCCQ
TPSNMVTPSIPPVYPSVDIDAHTESNHDTALTLACAGGHEELVSVLIARDAKIEHRDKKG
FTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDLLLARGANK
EHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHVPAVKL
LLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTPLMEAASGG
YAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLINRGAHIDVRNKKGNTP
LWLASNGGHFDVVQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQYLVKEVNQFPSDI
ECMRYIATITDKELLKKCHQCVETIVKAKDQQAAEANKNASILLKELDLEKSREESRKQA
LAAKREKRKEKRKKKKEEQKRKQEDEENKPKVNSEQPEGEDEENDEGVEQEIPIEPPSAT
TTTTIGISATSTTFTNVFGKKRANVVTTPSTNRKNKKNKTKESPSTAHLILPEPHMSLAQ
QKADKNKINGEPRGGGAGGNSDSDNIDSTDCNSESSSGGKSQEFSFTVDVNSTSDRRYPT
VVSSQEEKAVTTTSKTQTRLDCEVNANSMSTSYKSLPLSSPTMKLNLTSPKRGQKREEGW
KEVVRRSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGERMITIRGGTE
STRYAVQLINALIQDPAKELEDLIPKNHIRTPASTKSIHTNFSSGVGTTATSSKNTFPLG
APALVTSQATTLSTFQPTNKLSKSVPTNVRSPFPVSLPLAYPHPHFALLAAQTMQQIRHP
RLPMAQFGGTFSPSPNTWGPFPVRPVNPGNTSSSPKHNNTARLPNQNGPVLPSESPGLAT
AGCPITVSSVVAASQQLCMTNSRTPSSVRKQLFGCVPKTSPPAAVISSVTSTSSSLPSVS
STSITSGQVTTTFMPATTPQVQLSSQKVESFSVIPPPKEKASTQDQPLTNLCTPSPTANS
CNSSASNTSGAPETHPSSSPTPPSSTTQEEGQPSKVSDLNPVSMPFASNSESAPLTLASP
RLVAADNQDTGSLPQLAVPAPRVSHRMQPRGSFYSVVPNATLHQDPQSIFVTNPVPLTPP
QGPPTAVQLSSAVNIMNGSQVHINPANKSLQPTFGPATLFNHFSSLFDSGQVPANQGWGD
GPLPSRVAADASFTVQSAFLSNSVLGHLENVHPDNSKAPGFRPPSQRVSTSPVGLPSIDP
SGNSPSAASPLTSFSGIPGTRVFLQGPAPVGTPSFNRQHFSPHPWTSASNTSTSAPPTLG
QQPKGNSASQDRKIPPPIGTERLARIRQGGSVAQAPVGTSFVAPVGHSGIWSFGVNAVSE
GLSGWSQSVIGNHPMHQQLSDPNTFSQHQPMERDDSGMVAPTNIFHQPMGLPISMYGGTI
IPSHPQLADVPGGPLFNGLHNPDPAWNPMIKVIQNSTECTDAQQIWPGTWAPHIGNMHLK
YVN
NT seq 7572 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggacagtgggggcggcggcacctcctttgaggaggatttggactccgtagct
ccgcgatccgccccagctggggcctcggagccgcctccgccgggaggggtcgggctggga
atccgcaccgtgaggctttttggggaggctgggcccgcgccgggagtcggtggcggcggc
agcgcgggcggaggggacgcagcgctggatttcaagttggcggctgccgtgctgaggacg
ggcggcggaggtggtgcctctggaagcgacgaggacgaggtgtccgaggttgaatcattt
attttggaccaagaagatttggataacccagtccttaaaacgtcagagatattcttatca
agtacagcagaaggagcagatttacgcacagtagatccagagacccaagcgagactggaa
gctttgctagaagcagcaggaattggcaaattgtcaactgctgatggtaaagcttttgca
gatcctgaggttctccggagactgacgtcctcagttagctgtgcactggatgaagccgct
gccgcactgacacggatgagagcagagagcacacacagcacaggacaagtggacactcgc
agtctggcagaagcttgttcagatggagatgtgaatgccgttcgtaaattgctagatgaa
ggcagaagtgtaaatgaacatacagaagaaggagaaagcctgctgtgtttggcttgttca
gcaggatattatgaactagcacaagtactactagctatgcatgctaatgttgaagataga
gggaataaaggagatataactcctctgatggcagcttccagtggaggttatttagatatt
gtaaaattattacttcttcatgatgcagatgtcaactcccagtcagcaacagggaacact
gcactgacttatgcttgtgctggaggatttattgacattgtaaaagtgcttcttaatgag
ggtgcaaatatagaagaccataacgaaaatggacacactccgctgatggaagcagccagt
gcaggtcatgtggaggttgccagagttcttctagatcatggtgcgggcatcaacactcat
tctaatgagtttaaagaaagtgctctgacacttgcctgctacaaaggccatttggatatg
gttagatttctgcttgaagctggtgcagatcaagaacataaaacagatgagatgcacact
gccttaatggaagcttgcatggatgggcatgtagaggtcgcacgtttgcttttagacagt
ggtgctcaagtgaatatgcccgcagattcctttgagtccccattgactctagctgcctgt
ggtggacatgtcgaattggcagcactgcttattgaaagaggagcaaatcttgaagaagtt
aatgacgaaggatacacgcccttgatggaagctgctcgagaaggacatgaggagatggtg
gcacttctgttggcacaaggtgcaaatataaatgcccagacagaagaaactcaagaaact
gctcttaccttggcttgctgtggaggcttttctgaagttgcagatttcctgattaaggca
ggggctgacatagaacttggctgctctacacctctcatggaggcttctcaggagggacac
ctggagttagttaaatatttactggctgctggtgctaatgtgcatgctaccacagcaaca
ggagacacagctctaacctatgcttgtgaaaatggacatacagatgttgcagatgtttta
cttcaagcaggggcccatttagaacatgaatctgagggtggaagaacacctttgatgaaa
gctgcaagagctggtcacttgtgcactgttcagtttcttattagcaaaggtgccaatgtg
aatagggctacagccaataatgatcacacagtagtgtcactggcatgtgcaggaggccat
ttggcagtggttgaactactcttggctcatggagctgaccctactcatcgacttaaggat
ggatcaacaatgcttattgaagctgcaaaaggtggccatactaatgttgtttcttatctg
ttggattatccaaataatgttctgtcggttcccaccacagatgtgtctcaacttacctct
ccgtcacaagatgaatctcaggttccacgagtacccatacacacacttgccatggttgtg
cctccccaggaacctgacagaacttcgcaggagacgtctactgcccttttaggagtacaa
aaaggtgcatccaagcagaagtccagttctctgcaggtagcagatcaggacctactgcca
ccttttcacccataccagcctttggagtgcatagtagaagagactgaaggcaagctgaat
gaactggggcaaagaattagtgctattgaaaaagctcagcttaagtcattggagttaatt
caaggtgagcctctaaacaaggataagatagaagaacttaaaaagaacagagaagaacaa
gtccagaagaagaagaaaatactgaaagaactacagaaagtggaaaggcaattacagatg
aaaacacagcagcaatttaccaaagaatacttggaaaccaaaggtcagagagacgcagag
tctccaccccagcagtgctctcacagaggagtctttatggcaggggaagaagatggcagt
ctcccagaggaccactcttcagaatcgccccaagttgatacagtctcatttaaagatcat
ggtattgataagcaacagtctccatcatcggcagaacaaattaattttgtcccagtccag
cctctatcatctccacaaagtaacttttccggtgacttaggttctaatgggacaaattct
cttgtgcttcagaaagtatcaggtaaccagcagatcgtaggacagcctcagattgcaatt
gctggacatgagcaggggctgttagttcaagagccagatggactcatggttgcaactcca
gcccagacgcttaccgacactcttgatgacctgatagcagctgtcagtaccagagtgcct
gttggttcaaacaatccctctcagaccacagaatgtcccacacccgaatcctgttgtcag
actccaagcaatatggttaccccatcaattccccctgtgtatccttccgttgacattgat
gcacatacggaaagcaatcatgacacagctttaacactggcctgtgcgggtggtcacgaa
gaactcgtatctgttctcattgctcgggacgctaaaattgagcatagagacaaaaaaggt
tttaccccactgatcctggcggcaacagcagggcatgttggagttgttgaaatccttttg
gataaaggtggagatatagaggcacaatctgaacgaactaaagatactccgctttctttg
gcatgttctggtggacgacaggaggtggtagatttgctgctggcccgaggagccaataaa
gaacataggaatgtatctgattatacaccgctgagtctggctgcatctggaggatatgtg
aatattattaagattttgcttaatgctggggcagaaattaattcaaggactggaagtaaa
ctaggtatttctccattgatgttggctgcaatgaatggacatgttcctgcagtgaaattg
ctgcttgatatgggttcagacattaatgcacaaatagagaccaaccggaacacagctctc
accctagcctgtttccagggccgagcagaagtagtgagtttgcttttggaccgcaaagcc
aatgttgaacatagggcaaagactggtcttactcctttgatggaagcagcttctggagga
tatgcagaggttggaagagttctccttgataaaggagcagacgtcaatgcacctcctgtg
ccttcctcaagagatactgctttgacaatagcagcagacaaaggccactacaaattctgt
gagctcctgatcaacaggggagcacatattgatgttcgtaacaagaagggaaatacacca
ctttggctggcatccaatggtggtcattttgatgtagtacaattgctagtgcaagcaggg
gctgatgtggatgcagcagacaaccgaaaaatcacacctcttatgtcagcatttcgcaag
ggtcatgtaaaagttgttcagtatttggtgaaggaagtcaatcagtttccatctgatata
gagtgcatgagatacatagcaacaattacggataaggaactgctgaagaagtgtcaccaa
tgtgttgagacgattgtgaaggctaaagatcagcaggctgcagaagcaaataaaaatgca
agcattctcctaaaagagctagatctagaaaagtcaagagaagagagcagaaagcaagct
cttgcagccaaaagagagaagagaaaagaaaagagaaaaaagaagaaagaggaacaaaaa
aggaaacaggaagatgaagagaacaaacctaaagtgaattcagaacaaccagagggtgaa
gatgaagagaatgatgaaggtgtggagcaagaaatccccatagagcctccaagtgcaacc
accactactacaattggaatctctgctacgtctaccacgtttaccaatgtatttggcaaa
aaaagagccaatgtagtgacaactcccagcaccaatcggaaaaataagaagaataagaca
aaagagtctccttccacagcacatttaatcttacctgaaccacatatgtctttagcacaa
cagaaagcagataaaaataaaataaatggagaacctagaggtggtggtgcaggtgggaat
agtgattcggataacatagacagcacggactgcaacagtgagagcagcagtggtgggaag
agccaagagttcagtttcactgtggatgtgaattccaccagtgacaggaggtaccccaca
gttgtcagttctcaggaagaaaaggcagtcaccactacttccaagactcagacacgcctt
gactgtgaagtaaatgctaactccatgtcaaccagctacaagtcattgccattaagttct
ccaaccatgaaactgaatctcactagtcctaaaagaggtcagaaaagagaagaagggtgg
aaagaagttgttagaaggtcaaagaaactatctgttccagcctcagtggtgtccagaata
atgggaagaggaggatgcaacattacagcaatacaagatgttactggtgcccatattgat
gtggataaacaaaaagataagaatggagagagaatgatcacaatacggggtggtacagag
tcaacaagatacgcagttcagcttatcaatgcacttattcaagatcctgcaaaggaatta
gaagacttgattcctaaaaaccatatcaggacacctgccagtaccaagtccattcataca
aacttctcatctggagtaggcaccacagcaacttccagcaagaacacatttcccctgggt
gctccagctcttgtaacatcacaggcaacaacattatctacgttccagcccactaacaaa
cttagtaagagtgtgccaacaaatgtgcggtctcctttcccagtgtcgcttcccttagct
tatcctcatcctcattttgctcttctggctgctcaaactatgcaacaaattcggcatcct
cgcttacccatggcacagtttggaggaaccttctcaccttcacctaacacctggggacca
ttcccagtgagacctgtgaatcctggcaatacaagtagttctccaaagcataataataca
gcccgactacctaatcagaatggacctgttttaccatcagaatcgccaggactggctact
gctggttgtcctatcacggtctcttctgtagttgctgccagtcagcaactgtgtatgact
aattccaggactccctcatcagtcagaaagcagttgtttggttgtgtgcccaagaccagt
cctccagcagcagtgatttcctctgtgacaagcactagtagttccttgccgtctgtgtct
tccacatctatcactagtggacaagttaccaccacatttatgcctgcaactactcctcaa
gtacaactttcttcacaaaaggtggagtctttctctgtcataccgcctcccaaagagaaa
gcgtccacacaggaccagcccttgacaaacctatgtacaccatctccaactgctaacagt
tgtaatagctctgccagcaacacctcaggagcgccagaaactcatccatccagcagccct
actcctccttccagtactacacaagaggagggacagccatccaaggtgtctgatttaaat
cccgtgtcaatgccttttgcctctaactcagaatctgctccattgactttggcatcacca
agattggttgctgctgataatcaggacactggtagtttacctcagttagctgtaccagca
cctcgagtttctcatcgaatgcagcccagaggttctttttactcagtagtaccaaatgca
actctacaccaggatccccagtcaatttttgttaccaatccagttcctttaacaccgcca
caaggcccgccaactgcagtgcagctttcatcggctgtgaacattatgaacggctctcag
gtgcacataaacccagcaaataagtccttgcaacctacatttggcccagccacgcttttt
aatcacttcagtagtctttttgatagtggtcaggtgccagctaaccaagggtggggagat
ggacctctgccctcaagagttgctgcagatgcctctttcactgttcagtcagctttcctg
agtaactctgtacttggacacttggaaaatgtgcatcctgacaactccaaggcacctggc
ttcagaccaccatcacagagagtttctactagtccagttggattgccatccattgaccct
tcaggcaactccccatctgctgcttctcctctgacaagtttctctggcataccagggaca
agggttttcctacaagggccagcacctgtcggcactcctagttttaacagacaacatttt
tctccccacccttggacaagtgcctcaaacacatccacttctgcacctccaacattgggc
caacaaccaaaaggaaacagtgccagtcaggatcgaaagatacctcctcctattggaaca
gagaggttggccaggattcggcaaggaggatctgttgcacaagcccctgtagggaccagt
tttgttgctcctgttggacacagtgggatctggtcatttggtgtcaatgctgtgtcagag
ggcttatcaggttggtcacaatctgttataggaaaccatccaatgcatcaacagttatca
gacccaaacacattttcccagcatcaaccaatggagagagatgattctggaatggtagct
cccactaatatttttcaccagccaatgggtctgccaatttccatgtatggaggcaccatt
ataccctctcaccctcagcttgctgatgtcccggggggcccactgttcaatggacttcac
aacccagatcctgcttggaaccccatgataaaagttatccagaactcaactgaatgcact
gatgcccagcagatttggcctggcacgtgggcacctcatattggaaacatgcatctcaaa
tatgtcaactaa

DBGET integrated database retrieval system