KEGG   Rattus norvegicus (rat): 114495
Entry
114495            CDS       T01003                                 

Gene name
Map2k6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04218  Cellular senescence
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05145  Toxoplasmosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114495 (Map2k6)
   04015 Rap1 signaling pathway
    114495 (Map2k6)
   04668 TNF signaling pathway
    114495 (Map2k6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    114495 (Map2k6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114495 (Map2k6)
   04664 Fc epsilon RI signaling pathway
    114495 (Map2k6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    114495 (Map2k6)
   04935 Growth hormone synthesis, secretion and action
    114495 (Map2k6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    114495 (Map2k6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    114495 (Map2k6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114495 (Map2k6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114495 (Map2k6)
   05161 Hepatitis B
    114495 (Map2k6)
   05163 Human cytomegalovirus infection
    114495 (Map2k6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114495 (Map2k6)
   05169 Epstein-Barr virus infection
    114495 (Map2k6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114495 (Map2k6)
   05135 Yersinia infection
    114495 (Map2k6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114495 (Map2k6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    114495 (Map2k6)
   05022 Pathways of neurodegeneration - multiple diseases
    114495 (Map2k6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114495 (Map2k6)
   05418 Fluid shear stress and atherosclerosis
    114495 (Map2k6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114495 (Map2k6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     114495 (Map2k6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE7 family
   114495 (Map2k6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Seadorna_VP7 Pkinase_fungal CLP1_P Haspin_kinase Choline_kinase APH DUF4344
Other DBs
NCBI-GeneID: 114495
NCBI-ProteinID: NP_446155
RGD: 620666
Ensembl: ENSRNOG00000004437
UniProt: Q925D6
Position
10
AA seq 334 aa
MSQSKGKKRNPGLKIPREAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSADFVDFTSQCLKKNSK
ERPTYPELMQHPFFTVHEAKAADVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccccggccttaagattccaagggaagcgttt
gaacaacctcagaccagttccacgccgcctcgggatttagactccaaggcttgcatttct
attggaaaccagaactttgaggtgaaggccgatgacttggagcctatagtggagctggga
cgaggtgcgtacggggtggtggagaagatgcgtcacgtgcccagcgggcagatcatggcg
gtgaagcggatacgggccacagttaatagccaggagcagaaacggctactgatggatctg
gatgtttctatgaggacagtggactgtccgtttaccgtgaccttctatggtgcactcttc
cgggagggcgatgtgtggatctgcatggagctcatggatacgtcactagataaattctac
aaacaagttattgataaaggccaaacaattccagaagatatcttagggaagatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctctctgttatccatcgagatgtc
aagccttcaaatgtgctcattaacacgctgggccaagtgaagatgtgtgactttggaatc
agcggctacctggtagactctgttgcgaaaacgatcgatgccggttgcaaaccatacatg
gctcctgaacgaataaatccagagctcaaccagaaggggtacagtgtgaagtctgacatt
tggagtctgggcatcaccatgattgagctggccatcctccggtttccctatgattcttgg
ggaacgcccttccagcagctaaaacaggtggtagaagagccgtctccacaactcccagcg
gacaagttctctgctgacttcgttgactttacctcacagtgcttgaagaaaaattccaaa
gaacggcccacgtatccagagcttatgcaacatccatttttcaccgtccatgaagccaaa
gcagcagatgtggcgtctttcgtaaaactgatactcggggactaa

DBGET integrated database retrieval system