KEGG   Rattus norvegicus (rat): 114560
Entry
114560            CDS       T01003                                 

Gene name
Rap2a
Definition
(RefSeq) RAP2A, member of RAS oncogene family
  KO
K07837  Ras-related protein Rap-2A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    114560 (Rap2a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    114560 (Rap2a)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 AAA_24
Other DBs
NCBI-GeneID: 114560
NCBI-ProteinID: NP_446193
RGD: 620590
UniProt: Q78P65
Position
15q24
AA seq 105 aa
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKR
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcgcgagtacaaagtggtggtgctgggctcgggcggggtaggcaaatccgccctgacc
gtgcagttcgtgaccggcaccttcattgagaaatacgaccccaccatcgaggacttctac
cgcaaggagatcgaggtggactcgtcgccttcggtgttggagatcctggacacggcgggc
accgagcagttcgcgtccatgcgggacctgtacatcaagaacggccagggcttcatcctg
gtctacagcctggtcaaccagcagagcttccaggatatcaagcccatgcgggaccagatc
atccgcgtgaagcggtga

DBGET integrated database retrieval system