KEGG   Rattus norvegicus (rat): 114612
Entry
114612            CDS       T01003                                 

Gene name
Ddx39b
Definition
(RefSeq) spliceosome RNA helicase Ddx39b
  KO
K12812  ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114612 (Ddx39b)
  09122 Translation
   03013 RNA transport
    114612 (Ddx39b)
   03015 mRNA surveillance pathway
    114612 (Ddx39b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    114612 (Ddx39b)
   03041 Spliceosome [BR:rno03041]
    114612 (Ddx39b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114612 (Ddx39b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     114612 (Ddx39b)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   EJC/TREX
    114612 (Ddx39b)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    114612 (Ddx39b)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1
Other DBs
NCBI-GeneID: 114612
NCBI-ProteinID: NP_579834
RGD: 70923
Ensembl: ENSRNOG00000000841
Vega: OTTRNOG00000001724
UniProt: Q63413
Position
20
AA seq 428 aa
MAENDVDNELLDYEDDEVETAAGADGTEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAI
VDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMC
HTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALA
RNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCR
KFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRC
IALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAF
NYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI
SSYIEQTR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggcagagaacgatgtggacaatgagctcttggactatgaagacgatgaggtggagacg
gccgctggggcagatgggaccgaagctcccgccaagaaagacgtcaagggctcctatgtc
tccatccacagctccggctttcgagatttcctacttaagccagagttgctccgggccatt
gttgactgtggctttgagcatccatcagaggtccagcatgaatgcatcccccaggccatt
ctggggatggatgtcctgtgccaggccaagtcaggcatgggaaaaacagcagtgtttgtc
ctggccacactgcagcagctggagccagttactgggcaggtgtcagtgctggtgatgtgt
cacaccagggagctggctttccagatcagcaaggaatatgagcgcttctcaaagtacatg
ccgaatgtcaaggtggcagtgttttttggcggactgtctatcaagaaggatgaagaggtg
ctgaagaagaactgcccacacattgttgtggggactcctggccgaattctagccctggcc
cgaaataagagcctgaacctcaaacacattaaacactttatcttggacgaatgtgacaag
atgcttgaacagctcgacatgcgtcgggatgtccaggaaatttttcgcatgaccccccat
gagaagcaggtcatgatgttcagtgctaccttgagcaaagagatccgcccagtgtgccgc
aagttcatgcaagatcctatggagatcttcgtggatgacgagaccaagttgacgctgcac
gggttgcagcaatactacgtgaaactgaaggacaacgagaagaaccggaagctctttgac
cttctcgatgtcctcgagttcaaccaggttgtgatctttgtgaagtccgtgcagcgctgc
atcgccttggcccagcttctagtggagcagaacttcccagccattgctatccaccgcggg
atgccccaggaggagaggctctctcggtatcagcagttcaaggattttcagcggaggata
cttgtggctaccaacctgtttggccgtggcatggacattgagcgcgtgaacatcgctttc
aactatgacatgccagaggactccgacacctacctgcacagggtggccagagcgggccgg
tttggcaccaagggcttggccatcacatttgtgtcagacgagaacgatgccaagatcctg
aatgacgtgcaggaccgtttcgaggtcaacatcagtgagctgcccgatgagatcgacatt
tcctcctacattgaacagacacggtag

DBGET integrated database retrieval system