KEGG   Rattus norvegicus (rat): 116643
Entry
116643            CDS       T01003                                 

Gene name
Vcp
Definition
(RefSeq) valosin-containing protein
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05014  Amyotrophic lateral sclerosis
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    116643 (Vcp)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    116643 (Vcp)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    116643 (Vcp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    116643 (Vcp)
   04131 Membrane trafficking [BR:rno04131]
    116643 (Vcp)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    116643 (Vcp)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     116643 (Vcp)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Others
    116643 (Vcp)
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    116643 (Vcp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116643 (Vcp)
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N AAA_16 CDC48_2 AAA_2 AAA_5 AAA_33 AAA_22 TIP49 Vps4_C AAA_18 AAA_14 RNA_helicase Mg_chelatase IstB_IS21 Parvo_NS1 AAA_28 AAA_7 ATPase ATPase_2 Bac_DnaA ABC_tran AAA_17 DUF815 AAA_24 Viral_helicase1 TsaE Sigma54_activat NACHT NB-ARC ResIII DUF2075 Zeta_toxin UFD1 DUF3944
Other DBs
NCBI-GeneID: 116643
NCBI-ProteinID: NP_446316
RGD: 621595
Ensembl: ENSRNOG00000034242
UniProt: P46462
Position
5q22
AA seq 806 aa
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGNVYTEDNDDDLYG
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcctctggagccgattcaaaaggtgatgatttatcaacagccattctcaaacagaag
aaccgtcccaatcggttaattgttgatgaagccatcaatgaagataacagtgtggtgtcc
ttgtcccagcccaagatggatgaactacagttgttcagaggtgacacggtgttgctaaaa
ggaaagaagagaagggaagctgtatgcattgttctttctgatgacacgtgttctgatgag
aagattcgaatgaatagagttgttcggaataacctccgagttcgcctaggagatgtcatc
agcatccagccatgccctgatgtaaagtatggcaaacgtatccatgtgctacccattgat
gacacagtggaaggcatcactggcaatctttttgaggtataccttaagccgtacttcctg
gaagcatatcggcccatccgtaaaggagatattttccttgtccggggtgggatgcgtgct
gtggagttcaaagtagtagagacagatcccagcccttactgtattgttgctccagacaca
gtgatccactgtgagggggagccaatcaagcgagaggatgaggaggagtccttgaatgaa
gtaggctatgatgacatcggtggttgcaggaagcagctagctcagataaaggagatggtg
gagctgccactgagacatcctgcactctttaaggcaattggtgtgaagcctcctcgggga
atcttgctatatggacctcctgggacagggaaaaccttgattgcccgagctgtggcaaat
gaaactggagccttcttctttctgatcaatggtcctgaaatcatgagcaaattggctggt
gagtctgagagcaaccttcgtaaagcctttgaggaagctgaaaagaatgctcctgccatc
atcttcatcgacgagcttgatgccattgcacccaaaagagagaaaactcacggggaagtg
gagcgtcgcatcgtgtctcagttgttgacccttatggatggcctaaagcagagagcacat
gtgatagttatggcagcaaccaatagacccaacagcattgacccagccctacggcgattt
ggtcgctttgacagagaggtagatattggaatccctgatgctacaggacgtttggaaatt
cttcagatccataccaagaacatgaaactggcagatgatgtggacttggaacaggtagcc
aatgagactcatggtcatgtgggtgctgacttggcagccctgtgttcagaggctgctcta
caggccatccggaaaaaaatggacctcattgacctagaagatgagaccattgacgctgag
gtcatgaattccctggcagttactatggatgacttccggtgggccttaagtcaaagcaac
ccatcagcacttcgggaaactgtggtagaagtgccacaagtaacctgggaagacattgga
ggcctggaggatgtcaaacgggagcttcaggagttggttcagtatcctgtggagcatcca
gacaaattcctcaaatttggcatgactccttccaaaggtgttcttttctatggaccgcct
ggctgtgggaaaaccttactggccaaagccattgctaatgaatgccaggctaacttcatc
tccatcaagggtcctgagctgcttaccatgtggtttggggaatctgaggccaatgtcagg
gaaatatttgacaaggcacgacaagctgccccctgtgtactcttctttgatgagttagat
tcaattgccaaggctcgtggtggtaatattggagatggtggtggagctgcagaccgagtc
atcaatcagatcctgacagaaatggatggcatgtccacaaaaaagaatgtgtttatcatt
ggagctaccaaccggcctgacatcattgatcctgctatcctaagacctggccgtcttgat
cagctcatttatatcccacttcctgatgagaagtcccgtgttgccatcctaaaagccaat
ctgcgaaaatccccagttgccaaggatgtggatttggagttcttggctaagatgactaat
ggcttttctggagctgacctgacagaaatttgccaacgtgcttgtaaactagccattcgt
gaatctatcgagagtgagattaggcgagaacgagagaggcagacaaatccatcagctatg
gaagtagaagaggatgatccagtgcctgagatccgcagagatcactttgaggaagccatg
cgttttgcccgacgttctgtcagtgataatgacattcggaagtatgaaatgtttgcccag
acactgcagcaaagtcgaggttttggcagcttcagattcccttcagggaaccagggtgga
gctggcccaagtcagggcagtggaggtggcacaggtggcaatgtgtacacagaagacaat
gacgatgacctctatggctaa

DBGET integrated database retrieval system