KEGG   Rattus norvegicus (rat): 116680
Entry
116680            CDS       T01003                                 

Gene name
Ptpru
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, U
  KO
K16662  receptor-type tyrosine-protein phosphatase U [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    116680 (Ptpru)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     116680 (Ptpru)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    116680 (Ptpru)
SSDB
Motif
Pfam: Y_phosphatase MAM fn3 DSPc PTP_tm Y_phosphatase3 PTPlike_phytase Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 116680
NCBI-ProteinID: NP_001178504
RGD: 620782
Ensembl: ENSRNOG00000013515
UniProt: F1MAG7
Position
5q36
AA seq 1446 aa
MARAQALVLALTFQFCAPETETPAAGCTFEEASDPVVPCEFSQAQYDDFQWEQVRIHPGT
RTPADLPHGAYLMVNASQHAPGQRAHIIFQTLSENDTHCVQFSYFLFSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDHKGYIGLDDIL
LFSHPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFFLQRQSGVLVPAAGVRHI
SHRRFLATFPLASVGRSEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVNLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLLSRTKCAEPTRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYAVS
LCYHYTLGGSHNQTIRECVKMERGASRYTIKNLLPFRNVHVRLILTNPEGRKEGKEVTFQ
TDEDVPGGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
RTISKLRNETYHVFSNLQPGTTYLFSVRARTSKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVVVEEERPRRLRREPGGQDCFSVPLTFETALARG
LVHYFGAELAASSLLEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIIIIRKGRDRYAYS
YYPKPVNMAKATVNYRQEKTHMMTAVDRSFTDQSTLQEDERLGLSFMDAPGYSPRGDQRS
SGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKLKSGRQEPVSAYDRHRVKLHPMLGDPDADYISANYIDGYHRSNHFIA
TQGPKPEMIYDFWRMVWQEQCVSVVMISKLVEVGRVKCSRYWPEDSDMYGDIKITLVKTE
TLAEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
VVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
ILEACLCGETTIPVNEFKATYREMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
PRNRDKNRSMDVLPPDRCLPFLISSDGDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFVSGTANEDLVSRV
FRVQNSSRLQEGHLLVRHFQFLRWSAYRDTPDSRKAFLHLLAEVDKWQAESGDGRTVVHC
LNGGGRSGTFCACATVLEMIRCHSLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYL
EALELR
NT seq 4341 nt   +upstreamnt  +downstreamnt
atggcccgagctcaggctctggtcctggcgctcaccttccagttctgcgcgcccgagacc
gagactcccgcagctggctgcaccttcgaggaggcgagtgacccggttgtgccctgcgag
ttcagccaggctcagtatgatgacttccagtgggagcaagtacggatccaccctggcacc
cggacccctgcagacctgccccatggtgcctacttgatggttaatgcttcccagcatgct
ccaggccagagggcccatatcatcttccagaccctgagcgagaacgacacccactgtgtg
cagttcagctacttcctgtttagccgggatgggcacagcccaggcaccctgggcgtctat
gtgcgtgtgaacgggggccctctgggcagtgccgtgtggaatatgactggatcccacggc
cgtcagtggcatcaggctgaactggctgtcagcaccttctggcccaatgagtatcaggtg
ctgtttgaggctctcatctccccagaccataagggctacataggcttagatgacatcttg
ctattcagccatccctgcgcgaaggcccctcacttctcccgccttggagacgtggaggtc
aatgcgggccagaatgcatccttccaatgcatggcagcaggcagagctgcagaggcagag
cgtttcttcctgcagcggcagagtggggtgctagtgcctgcggctggggtgcggcacatc
agtcaccgtcgcttcctggccacttttccactggcctctgtaggccgctcggagcaggat
ctgtaccgttgcgtgtcccaggccccgcgcggtgctggagtctccaacttcgcagagctc
atcgtcaaagagcctcccacccccatcgcgcccccacagctgctgcgtgcaggccccacc
tacctcatcatccagctcaacaccaactccatcattggcgacgggccgatcgtgcgcaag
gagatcgagtaccgaatggcacggggcccgtgggccgaggttcacgctgtcaacctgcag
acctacaagctgtggcatctagacccggacactgagtatgagatcagcgtgctgcttacc
cgcccgggagatggaggcacaggccgcccagggccaccactgctcagccggaccaagtgc
gcagagcccacgagggcccccaagggcctggcttttgctgagatccaggctcgtcagctg
accctgcagtgggagcccctgggctacaatgtcacgcgttgtcatacctatgctgtgtcc
ctttgttatcactacaccctgggcggcagccacaaccagaccatccgggagtgtgtgaag
atggagcggggcgccagccgctacaccatcaagaatctgctgccgttcaggaacgtccac
gtgcgtctgattctcacaaaccctgaggggcgcaaggagggcaaggaggtcaccttccag
acagatgaagatgtgcctggtgggatcgccgctgagtctctcaccttcaccccactagag
gacatgatctttctcaagtgggaggagccccaggaacccaatggcctcatcactcagtat
gagatcagctaccaaagcattgagtcctcagacccagcggtgaacgtgcccggcccgaga
cgcaccatctccaaactccgaaatgagacttaccatgtcttctccaacctgcaacccggc
accacatacctgttctctgtgcgtgctcgtacaagcaagggctttggccaggcggctctc
accgagataaccaccaacatctcagcacccagctttgattatgccgacatgccgtcaccc
ctgggcgagtctgagaacaccatcactgtgctgttgaggccggcccagggccgaggagca
cccatcagcgtctaccaggtggttgtggaggaagagcggccacggcgcttgcggcgcgag
cctggaggtcaggactgcttctcggtacctctgacctttgagacggccctggctcgcggc
ctggtgcactactttggggctgaactggctgccagcagcctgcttgaggccatgcccttc
actgtgggtgacaaccagacctatcgtggcttctggaacccaccgcttgagcccaggaag
gcctacctcatctatttccaggcagcgagccacctgaaaggggaaacccgactgaactgc
atccgaattgccaggaaagctgcgtgcaaggagagcaagcgacccctcgaagtgtcccag
aggtcggaggagatggggctcatcctgggtatctgtgcaggtggccttgccgtcctcatt
ctcctcctgggcgccatcattatcatcatccgtaaagggagggaccgctatgcctactct
tactacccgaagccagtgaacatggcaaaagccacggtcaactatcgccaggagaagacc
cacatgatgactgctgtggaccgtagcttcacagatcagagcactctgcaggaggatgag
cggctgggcctgtccttcatggatgctcctggctacagccctcggggagaccagagaagc
agtggggtcactgaggccagtagcctcctggggggctctcctcggcgcccctgtggccgg
aagggctccccgtatcacacagggcagcttcaccctgcagtacgagtggctgacctgctg
cagcacatcaaccagatgaagacagccgagggctacggcttcaagcaagagtacgagagt
ttctttgaaggctgggatgccaccaagaagaaagacaagctgaagagcggccggcaggag
ccagtgtctgcctatgaccgacaccgagtgaagctgcacccgatgctgggagaccctgat
gccgactacatctctgccaactacatagacggctaccacaggtcaaaccacttcatagcc
actcaagggccaaagcctgagatgatctacgacttctggcgcatggtgtggcaggagcag
tgtgtgagcgtcgtcatgatcagcaagctggtagaggtgggcagggtaaagtgctctcga
tactggcccgaggactcagacatgtatggggacatcaagatcacgctggtaaagacagag
acactggctgagtacgtggtgcgcacctttgccctggagcggagaggttactcagcccgg
catgaggtccgccagttccacttcacagcgtggccagagcatggtgttccctaccatgcc
acggggctgctggccttcatccggcgcgtgaaggcttccactccacctgatgctgggcct
gttgtcattcactgcagtgcaggcactggccgcacaggctgctacatcgtcttggatgtg
atgctggacatggctgagtgtgagggggtcgtggacatttacaactgcgtgaagaccctc
tgttcccggcgggtcaacatgatccagaccgaggaacaatacatcttcatccacgatgcg
attctggaggcctgcctgtgtggggagaccaccatccctgtcaatgagttcaaggccacc
tatagggagatgatccgcattgaccctcagagtaactcctcccagcttcgggaagagttc
cagacactgaactcggtcacaccgccgctggacgtggaggagtgtagcattgccctgctg
ccccggaatcgagacaagaaccgtagcatggacgtgctgccgccagaccgctgcctgccc
ttcctcatctccagtgatggggaccccaacaactacatcaatgcagccctaactgatagc
tacacacggagcgccgccttcatcgtgaccctgcacccactgcagagtaccacacccgac
ttctggcggctggtctacgactatgggtgcacctccattgtgatgctcaaccagcttaac
cagtccaactccgcctggccctgcctgcagtactggccagaaccaggcagacagcagtat
ggcctcatggaggtggagtttgtgtctggcacagcaaacgaggatctggtgtcccgagtg
ttccgggtgcagaactcttcaaggctgcaggagggccacctgctggttcgtcactttcag
ttcctgcgttggtctgcttatcgggacacgcctgactccaggaaggccttcctgcacctg
ttggctgaggtggacaagtggcaggcggagagtggagatgggcgcaccgtggtgcattgt
ctcaatggcggtggccgcagtggcaccttctgcgcctgtgcaacggtcttggaaatgatc
cgctgtcacagcctggtggatgttttctttgctgccaaaacgcttcggaactacaagccc
aatatggtggagaccatggatcaataccatttctgctacgatgtggccctggagtacctg
gaggctctggagttgagatag

DBGET integrated database retrieval system