KEGG   Rattus norvegicus (rat): 170913
Entry
170913            CDS       T01003                                 

Gene name
Abcb1a, Abcb1, Mdr1a
Definition
(RefSeq) ATP binding cassette subfamily B member 1A
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04976  Bile secretion
rno05206  MicroRNAs in cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    170913 (Abcb1a)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    170913 (Abcb1a)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    170913 (Abcb1a)
  09162 Cancer: specific types
   05226 Gastric cancer
    170913 (Abcb1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    170913 (Abcb1a)
   04147 Exosome [BR:rno04147]
    170913 (Abcb1a)
   04090 CD molecules [BR:rno04090]
    170913 (Abcb1a)
Enzymes [BR:rno01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     170913 (Abcb1a)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    170913 (Abcb1a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   170913 (Abcb1a)
CD molecules [BR:rno04090]
 Proteins
  170913 (Abcb1a)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_22 Rad17 RsgA_GTPase G-alpha Zeta_toxin AAA AAA_5 AAA_29 AAA_7 AAA_14 APS_kinase AAA_30 AAA_15 PRK NTPase_1
Other DBs
NCBI-GeneID: 170913
NCBI-ProteinID: NP_596892
RGD: 619951
Ensembl: ENSRNOG00000008012
UniProt: Q9JK64
Position
4q12
AA seq 1272 aa
MELEEDLNGRADKNFSKMGKKSKKEKKEKKPAVSVLTMFRYAGWLDRFYMLLGTLAAIIH
GIALPLMMLVFGDMTDSFANVGNNRSMSFYNATDIYAKLEDEMTTYAYYYTGIGAGVLIV
AYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGD
KIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELQAYA
KAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYA
SYALAFWYGTSLVISKEYTIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFSI
IDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKDVQILKGLNLKVKSGQTVALVGN
SGCGKSTTVQLLQRLYDPIEGEVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENI
RYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRN
PKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVE
QGNHDELMREKGIYFKLVMTQTAGNEIELGNEACESKDGIDNVDMSSKDSGSSLIRRRST
RKSIRGPHDQDGELSTKEALDDDVPPASFWRILKLNSTEWPYFVVGVFCAIINGGLQPAF
SIIFSKVVGVFTKNDTPEIQRQNSNLFSLLFLILGIISFITFFLQGFTFGKAGEILTKRL
RYMVFKSMLRQDISWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVITQNIANLGTGII
ISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVV
SLTREQKFETMYAQSLQIPYRNALKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAREL
MTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKAKVSASHIIRIIEKIPEIDSYSTEGLKP
NMLEGNVKFNGVMFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYD
PMAGTVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSHEEIVKA
AKEANIHQFIDSLPEKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDT
ESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGQVKEHGTHQQLLAQKGIYF
SMVSVQAGAKRS
NT seq 3819 nt   +upstreamnt  +downstreamnt
atggagctcgaagaagaccttaacggaagagcagacaagaacttctcaaagatgggcaaa
aagagtaaaaaggagaagaaagaaaagaaaccagcggtcagtgtgctcacaatgtttcgc
tatgcaggttggctggacagattttacatgctgctgggaactctggcggccattatccat
ggaattgcgctcccacttatgatgctggtctttggagacatgacagatagctttgcaaat
gtaggaaacaaccgtagtatgagtttctacaatgctacagacatatatgccaagctggag
gacgaaatgaccacgtacgcctactattacacgggcattggtgccggtgtgctcatcgtt
gcctacatccaggtttcactttggtgcctggcagctgggagacaaatacacaagattagg
cagaagtttttccatgccatcatgaatcaggagataggctggtttgacgtgcatgacgtt
ggggagctcaacacccggctcacagatgacgtctccaaaattaatgaaggaattggtgac
aaaattggaatgttctttcaggcaatggcaacattttttggtggttttataataggattt
actcgcggctggaagctaactcttgtgattttggccatcagccctgttcttggactgtca
gctggtatttgggcaaagatattgtcttcatttactgataaggaactccaggcttatgca
aaagctggagcagttgctgaagaagtcttagcagccatcagaactgtgattgcctttgga
ggacaaaagaaggaacttgaaaggtacaataacaatttggaagaagctaaaaggcttggg
ataaagaaagctatcacggccaacatttccatgggtgcagcttttctgcttatctatgca
tcatatgctctggcattctggtatgggacttccttggtcatctcaaaagaatacactatt
ggacaagtgctcactgtctttttttctgtattaattggagcattcagtgttgggcaggca
tctccaaatattgaagccttcgccaatgctagaggagcagcttatgaagtcttcagtata
attgataataagcccagtatagacagcttctcaaagagtgggcacaaacccgacaacata
caaggaaatttggaattcaaaaatattcacttcagttacccgtctcgaaaagacgttcag
atcttgaagggcctcaacctgaaggtgaagagcgggcagacggtagccctggttggcaac
agtggctgtgggaaaagcacaactgtccagctgctgcagaggctctacgaccccatagag
ggcgaggtcagtatcgacggacaggacatcaggaccatcaatgtgaggtatctgcgggaa
atcattggggtggtgagtcaggaacccgtgctgtttgccaccacaattgccgaaaacatt
cgctatggccgagaaaacgtcaccatggatgagatagagaaagctgtcaaggaagccaat
gcctatgatttcatcatgaaactgccccacaaatttgacaccctggttggtgagagaggg
gcgcagctgagtgggggacagaaacagaggatcgccattgcccgggccctggtccgcaac
cccaagatccttttgttggatgaggccacgtcagccttggacacagaaagcgaagccgtg
gttcaggccgctctggataaggctagagaaggccggaccaccattgtgatagctcaccgc
ttgtctacagttcgcaatgctgacgtcattgctggttttgatggtggtgtcattgtggag
caaggaaatcatgatgagctcatgagagagaaaggaatttacttcaaacttgtcatgact
cagacagcaggaaatgaaattgaattaggaaatgaagcttgtgaatctaaagatggaatt
gataatgtggacatgtcttcaaaagattcaggatccagtctaataagaagaagatcaact
cgcaaaagcatccgtgggccacatgatcaagacggggaacttagcaccaaagaggctctg
gatgacgacgtacctccagcttccttttggcggatcctgaagttgaattcaactgaatgg
ccttattttgtggttggtgtattttgtgccataataaatggaggcttgcaaccagcattc
tccataatattttcaaaggttgtaggggtttttacaaaaaatgacacccctgaaatccag
cggcagaacagcaacttgttttctttattgttcctgatccttgggatcatctctttcatt
acgtttttccttcagggcttcacatttggcaaagctggagagatcctcaccaagcgactc
cgatacatggtcttcaaatccatgctgagacaggacataagctggtttgatgaccctaaa
aacaccacaggagcgctgaccaccaggcttgccaatgacgctgctcaagtgaaaggggct
acagggtctaggcttgctgttattacccagaacatagcaaatcttgggacaggcatcatc
atatccctgatctacggctggcaattgacacttttactcctagcaattgttcccatcatt
gctatagcaggagtggttgaaatgaaaatgttgtctggacaagcgctgaaagataagaag
gaactagaaggttctgggaagatcgctacagaagcaattgaaaactttcgcactgtcgtc
tctttgactcgggagcagaagtttgaaactatgtatgcccagagcttgcagataccatac
agaaatgctttgaagaaagcgcacgtctttgggatcactttctccttcacccaggccatg
atgtatttctcctatgctgcttgtttccggtttggtgcctacttggtggcacgagaactc
atgacatttgaaaatgttctgttagtattctcagctattgtctttggtgccatggcagtg
gggcaggtcagttcattcgctcctgactacgcgaaagccaaagtctcggcatcccacatc
atcaggatcattgagaaaatccctgagattgacagctacagcacggagggcttgaagcct
aatatgttggaaggaaatgtgaaatttaatggagtcatgttcaactatcccacccgaccc
aacatcccagtgcttcaggggctgagcctagaggtgaagaaagggcagacgctggccctc
gtgggcagcagtggctgcgggaagagtacagtggtccagctgcttgagcgcttctatgac
cccatggccggaacagtgtttctagatggcaaagaaataaagcaactcaatgtccagtgg
ctccgcgcccacctgggcattgtgtcccaggagcccatcctgtttgactgcagcatcgcc
gagaacattgcctacggagacaacagccgtgtcgtgtctcatgaggagatcgtgaaggca
gccaaggaggccaacatccaccagttcatcgactcactgcctgagaaatacaacaccaga
gtgggagacaaagggactcagctgtcgggcgggcagaagcagcgcatcgccatcgcgcgc
gccctcgtcagacagcctcacatcttacttctggatgaagcgacatcagctctggatacg
gagagtgaaaaggtcgtccaggaagcgctggacaaagccagggaaggccgcacctgcatt
gtgatcgcgcaccgcctgtccaccatccagaacgcagacttgatcgtggtgattcagaac
ggccaggtcaaggagcacggcacccaccagcagctgctggcccagaaaggcatctatttc
tcgatggtcagtgtgcaggctggagcaaagcgctcatga

DBGET integrated database retrieval system