KEGG   Rattus norvegicus (rat): 171045Help
Entry
171045            CDS       T01003                                 

Gene name
Mmp3
Definition
(RefSeq) matrix metallopeptidase 3
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05202  Transcriptional misregulation in cancer
rno05215  Prostate cancer
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    171045 (Mmp3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    171045 (Mmp3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    171045 (Mmp3)
  09162 Cancer: specific types
   05215 Prostate cancer
    171045 (Mmp3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    171045 (Mmp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    171045 (Mmp3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     171045 (Mmp3)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M10
   171045 (Mmp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin DUF4953 Reprolysin_5 Reprolysin_4 Reprolysin_3 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 171045
NCBI-ProteinID: NP_598207
RGD: 621317
Ensembl: ENSRNOG00000032626
Position
8q11
AA seq 475 aa AA seqDB search
MKGLPVLLWLCTAVCSSYPLHGSEEDAGMEVLQKYLENYYGLEKDVKQFTKKKDSSPVVK
KIQEMQKFLGLKMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKNHISYRIVNYT
LDLPRESVDSAIERALKVWEEVTPLTFSRISEGEADIMISFAVEEHGDFIPFDGPGMVLA
HAYAPGPGINGDAHFDDDERWTDDVTGTNLFLVAAHELGHSLGLFHSANAEALMYPVYKS
STDLARFHLSQDDVDGIQSLYGPPTESPDVLVVPTKSNSLDPETLPMCSSALSFDAVSTL
RGEVLFFKDRHFWRKSLRTPEPGFYLISSFWPSLPSNMDAAYEVTNRDTVFILKGNQIWA
IRGHEELAGYPKSIHTLGLPETVQKIDAAISLKDQKKTYFFVEDKFWRFDEKKQSMDPGF
PRKIAENFPGIGTKVDAVFEAFGFLYFFSGSSQLEFDPNAGKVTHILKSNSWFNC
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggctcccagtcctgctgtggctgtgtacggctgtgtgctcatcctacccattg
catggcagtgaagaagatgctggcatggaggttctgcagaaatacctagaaaactactat
ggtcttgaaaaggatgtgaagcagtttactaagaaaaaggacagtagccctgttgtcaaa
aaaattcaagaaatgcagaagttccttgggctgaagatgacagggaagctggactcgaac
actatggagctgatgcacaagccccggtgtggtgttcccgacgtcggtggcttcagtacc
tttccaggttcacccaaatggaggaaaaaccacatctcctacaggattgtgaattataca
ctggatttaccaagagagagtgtggattctgccattgagagagctttgaaggtctgggag
gaggtgaccccactcacattctccaggatctctgaaggagaggctgacataatgatctcc
tttgcagttgaagaacatggagactttatcccttttgatgggcctggaatggtcttggct
catgcctatgcccctggaccagggattaatggagatgctcactttgatgatgatgaacga
tggacagatgatgtcacaggtaccaacctattcctggttgctgctcatgaacttggccac
tccctgggtctctttcactcagccaatgctgaagctttgatgtacccagtctacaagtcc
tccacagacctggcccgtttccatctctctcaagatgatgtagatggtattcaatccctc
tatggacctcccacagaatcccctgatgtcctcgtggtacccaccaaatctaactctctg
gaccctgagaccttaccaatgtgtagctctgctttgtccttcgatgcagtcagcaccctg
cggggagaagtcttgttctttaaagacaggcacttttggcgaaaatctctcaggacccct
gagcctggcttttatttgatctcttcattttggccgtctcttccatccaacatggatgct
gcatatgaagttactaacagagacactgttttcattcttaaaggaaatcagatctgggct
atccgaggtcatgaagagctagcaggttatcctaaaagcattcacactctgggcctccct
gaaaccgtccagaagatcgatgcagccatttctttaaaggaccaaaagaagacgtacttc
tttgtagaggacaaattctggagatttgatgagaagaaacaatccatggatccaggattt
cccaggaaaatagctgagaactttccaggcattggcacaaaggtggatgctgtctttgaa
gcatttgggtttctttacttcttcagcggatcttcacagttggagtttgatccaaatgca
gggaaagtgacccacatattgaagagcaacagctggtttaattgttaa

DBGET integrated database retrieval system