KEGG   Rattus norvegicus (rat): 171052Help
Entry
171052            CDS       T01003                                 

Gene name
Mmp13
Definition
(RefSeq) matrix metallopeptidase 13
  KO
K07994  matrix metalloproteinase-13 (collagenase 3) [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    171052 (Mmp13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    171052 (Mmp13)
   04928 Parathyroid hormone synthesis, secretion and action
    171052 (Mmp13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    171052 (Mmp13)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     171052 (Mmp13)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M10
   171052 (Mmp13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_4 Reprolysin_5 DUF4953
Motif
Other DBs
NCBI-GeneID: 171052
NCBI-ProteinID: NP_598214
RGD: 620196
Ensembl: ENSRNOG00000008478
UniProt: G3V742
Position
8q11
AA seq 472 aa AA seqDB search
MHSAILATFFLLSWTHCWSLPLPYGDDDDDDLSEEDLEFAEHYLKSYYHPVTLAGILKKS
TVTSTVDRLREMQSFFGLDVTGKLDDPTLDIMRKPRCGVPDVGEYNVFPRTLKWSQTNLT
YRIVNYTPDISHSEVEKAFRKAFKVWSDVTPLNFTRIHDGTADIMISFGTKEHGDFYPFD
GPSGLLAHAFPPGPNLGGDAHFDDDETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGAL
MFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGE
TMIFKDRFFWRLHPQQVEPELFLTKSFWPELPNHVDAAYEHPSRDLMFIFRGRKFWALNG
YDIMEGYPRKISDLGFPKEVKRLSAAVHFEDTGKTLFFSGNHVWSYDDANQTMDKDYPRL
IEEEFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSLLWC
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagctattctggccaccttcttcttgttgagttggactcactgttggtccctg
ccccttccctatggtgatgatgatgatgatgacttgtctgaggaagatcttgagtttgca
gagcactacttgaaatcatactaccatcctgtgactcttgcgggaatcctgaagaagtct
acagtgacctctacagttgatagactccgagaaatgcagtctttctttggcttagatgtg
actggcaaacttgatgatcctaccttagacatcatgagaaaaccaagatgtggagtgcct
gatgtgggtgaatacaatgttttccctcgaacactcaaatggtcccaaacaaacttaact
tacagaattgtgaactacacccctgatatatcccattctgaagtggagaaggccttcaga
aaagccttcaaggtctggtctgatgtgacacctctgaattttaccaggatccatgatggc
actgctgatatcatgatatcttttggaactaaagaacatggtgacttctacccatttgat
gggccttctggtcttctggcacacgcttttcctcctggaccaaaccttggcggggacgcc
cattttgatgatgatgaaacctggacaagcagctccaaaggctacaacttatttattgtt
gctgcccatgagcttggccactccctcggtctggaccactccaaggaccctggagccctg
atgtttcccatctatacctacactggcaaaagccatttcatgctcccagatgatgacgtt
caaggaatccagtctctctatggtccaggagatgaagaccccaaccctaagcaccccaaa
acaccagagaagtgtgacccagccctatcccttgatgccattactagtctccgaggagaa
accatgatctttaaagacagattcttctggcgtctgcaccctcagcaggttgagcctgaa
ctgtttttgaccaagtccttttggccagaacttcccaaccatgtggatgctgcatacgag
catccatcccgagacctcatgttcatctttagagggagaaaattctgggccctgaatggg
tatgacattatggagggttatcccagaaaaatatctgacctgggatttccaaaagaggtg
aaaaggctcagtgctgcggttcactttgaggacacggggaagaccctcttcttctcaggg
aaccacgtgtggagttatgatgatgctaaccagactatggacaaagactatccccgcctc
atagaagaagaattccctggaattggcgacaaagtagatgctgtctatgagaaaaatggc
tatatctactttttcaatgggcccatacagtttgaatacagtatctggagtaatcgcatt
gtgagagtcatgccaacaaattccttattgtggtgttaa

DBGET integrated database retrieval system