KEGG   Rattus norvegicus (rat): 171099Help
Entry
171099            CDS       T01003                                 

Gene name
Rasd2, Rhes
Definition
(RefSeq) RASD family, member 2
  KO
K07844  RASD family, member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    171099 (Rasd2)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   RasD
    171099 (Rasd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU SRPRB TniB AAA_16
Motif
Other DBs
NCBI-GeneID: 171099
NCBI-ProteinID: NP_598252
RGD: 628594
Ensembl: ENSRNOG00000014761
UniProt: P63033
Position
19p11
AA seq 266 aa AA seqDB search
MMKTLSSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVY
NIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVK
SCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEAELLVSGDENCAYFEVSAKKNTNVN
EMFYVLFSMAKLPHEMSPALHHKISVQYGDAFHPRPFCMRRTKVAGAYGMVSPFARRPSV
NSDLKYIKAKVLREGQARERDKCSIQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaccttgtccagcgggaactgcacactcaacgtgcccgctaagaactcctac
cgcatggtggtgctgggtgcctcccgggtgggcaagagctccattgtctcccgtttcctt
aatggccgctttgaggatcagtacacacccaccatcgaggactttcatcgcaaggtgtac
aacatccatggggacatgtaccagctggacatcctggacacctctggtaaccatccgttc
cctgccatgcgccggctgtctatcctcacaggagacgtcttcatcctggtgtttagcctg
gatagccgggagtccttcgacgaggtcaagcgcctccagaaacagatcctggaggtcaag
tcctgcctgaagaataagaccaaggaggccgcagagctgcctatggtgatctgtgggaac
aagaatgaccacagtgagctgtgccgccaggtccctgccatggaggcggaactgttggtg
tccggggatgaaaactgcgcctacttcgaggtgtcagccaagaagaacacgaacgtaaac
gagatgttctacgtgctgttcagcatggccaagctgccccacgagatgagccctgcactg
caccacaagatctccgtgcagtacggtgacgccttccacccccggcccttctgcatgcgt
cgcaccaaggtcgcaggtgcctatggcatggtctcgcccttcgcccgccgccccagtgtc
aacagtgacctcaagtatatcaaggccaaggtcctacgggagggccaggcccgagagagg
gacaagtgcagcatccagtga

DBGET integrated database retrieval system