KEGG   Rattus norvegicus (rat): 171390
Entry
171390            CDS       T01003                                 

Gene name
Nlrp6, Avr, Nalp6, Navr, Navr/Avr, Non-AVR
Definition
(RefSeq) NLR family, pyrin domain containing 6
  KO
K20863  NACHT, LRR and PYD domains-containing protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    171390 (Nlrp6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    171390 (Nlrp6)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   171390 (Nlrp6)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH Ribosomal_60s AAA_16 DUF3764
Other DBs
NCBI-GeneID: 171390
NCBI-ProteinID: NP_599202
RGD: 708549
Ensembl: ENSRNOG00000045677
UniProt: Q63035
Position
1q41
AA seq 880 aa
MDAAGASCSSSEAVARELLLAALQDLSQEQLKRFRHKLRDAPLDGRSIPWGRLEHSDAVD
LTDKLIEFYAPEPAVDVTRKILKKADIRDVSLRLKEQQLQRLGSSSALLTVSEYKKKYRE
HVLRQHAKVKERNARSVKINKRFTKLLIAPGSGAGEDELLGTSGEPEPERARRSDTHTFN
RLFRGNDDEGPRPLTVVLQGPAGIGKTMAAKKILYDWAGGKLYHSQVDFAFFMPCGELLE
RPGTRSLADLILEQCPDRTAPVRRILAQPHRLLFILDGADELPTLAAPEATPCRDPFEAT
SGLRVLSGLLSQELLPAARLLVTSRNATLGRLQGRLCSPQCAEVRGFSDKDKKKYFFKFF
RDERKAERAYRFVKENETLYALCFVPFVCWIVCTVLLQQMELGRDLSRTSKTTTSVYLLF
ITSMLKSAGTNGPRVQGELRMLCRLAREGILKHQAQFSEKDLERLKLQGSQVQTMFLSKK
ELPGVLETVVTYQFIDQSFQEFLAALSYLLDAEGAPGNSAGSVQMLLNSDAGLRGHLALT
TRFLFGLLSTERIRDIGNHFGCVVPGRVKQDTLRWVQGQSQPKVATVGAEKKDELKDEEA
EEEEEEEEEEEELNFGLELLYCLYETQEDDFVRQALSSLPEMVLERVRLTRMDLEVLSYC
VQCCPDGQALRLVSCGLVAAKEKKKKKKSFMNRLKGSQSTGKQPPASLLRPLCEAMITQQ
CGLSILTLSHCKLPDAVCRDLSEALKVAPSLRELGLLQNRLTEAGLRLLSQGLAWPKCKV
QTLRIQMPGLQEVIHYLVIVLQQSPVLTTLDLSGCQLPGTVVEPLCSALKHPKCGLKTLS
LTSVELTENPLRELQAVKTLKPDLAIIHSKLGTHPQPLKG
NT seq 2643 nt   +upstreamnt  +downstreamnt
atggatgccgctggagcctcctgctccagctcggaggcggtggcaagggaactgcttctg
gccgcactgcaggatctgagccaggagcagctgaagcgttttcgccacaagctccgggat
gcgcccctggatggccgcagcatcccgtgggggcgactggagcactcagacgctgtggac
ctcacagacaagctgattgagttctatgcgccagagccagccgtagatgtgacccgaaag
atcctgaagaaggcggatattcgagatgtgtcgttgcgactcaaggagcagcagctgcag
aggctcggctccagctcggcgcttctcaccgtgtcggagtacaagaagaagtaccgcgag
cacgtgctacgacagcatgctaaggtgaaggagaggaatgcccgctccgtgaagatcaac
aagcgcttcaccaagctgctcattgcgccggggagcggcgccggggaggacgagctgctg
ggaacgtcgggggagcccgagcccgagcgcgcaaggcgctcggacacacacactttcaat
cggctcttccgaggaaatgatgacgagggcccgcggccgctgaccgtggtgctgcagggc
ccggcaggcatcggcaaaaccatggccgccaagaaaatcctctacgactgggcaggaggc
aagctataccacagccaagtggactttgccttcttcatgccgtgcggcgagctgctggag
cggccaggtacgcgcagcttggcggacctgatactggaacagtgcccggaccgcaccgcg
ccggtgcggcggatactagcgcaaccgcatcgtctactgttcatcctggacggtgcagac
gaattgcctactttagcagccccagaagccactccctgcagagaccctttcgaggctacg
agtggcttgagagtgctgagcgggctgctgagccaggagctgttaccagcggctcgcttg
ctggtgacttcacgcaacgccaccctcgggaggctgcagggcagactttgctcaccacag
tgcgcagaagtgcgcggcttctcagacaaagacaagaaaaagtatttcttcaagtttttc
cgggacgagaggaaggcagagcgcgcttaccgcttcgtgaaagagaatgagacgctgtac
gcactgtgctttgtgccgtttgtgtgctggatcgtgtgcaccgtgctgctgcagcaaatg
gagctgggccgggatctgtctcgtacctccaagaccactacatctgtgtacctgctcttc
atcaccagcatgctgaagtctgcaggtaccaatggaccccgggttcagggagagctgcga
atgctgtgccgcctggcccgggagggcatcctgaagcatcaagcacagttctcagaaaag
gacctggagagattgaagcttcagggttcccaagttcagacaatgtttctcagcaagaag
gagctgccaggagtgctagaaactgtggtcacctaccagttcattgaccagagcttccag
gagttcttggctgcattgtcatacctactagacgctgagggagccccagggaactccgca
ggaagtgtgcagatgctcctgaactctgacgcggggctgcgtggtcatctggcactcacc
actagattcctctttggactgctaagtacagagaggattcgtgacattggaaaccatttt
ggctgtgtggtgccagggcgtgtgaaacaggacaccttgcggtgggtacaaggacaaagc
caacccaaggtggcgacagtaggagcagaaaagaaggatgagctgaaggacgaggaagca
gaggaggaggaggaggaggaagaagaggaggaggaactcaactttggactggagctgttg
tactgcctgtatgagacacaagaggatgattttgttcgccaggctctcagcagccttcca
gagatggtactggagcgagttaggctgacccgcatggaccttgaggttctgagctactgc
gtgcagtgctgcccggacggccaggctctgagactggtgagctgtggactggtggcggca
aaggagaagaagaagaagaagaagagcttcatgaaccggctgaagggttctcaaagcacc
gggaaacaacccccagcctccttgctgcgtccactctgtgaggcaatgattacccagcaa
tgtggtctgagtattctgaccttgtcacactgcaaactccctgatgcagtttgtcgagac
ctttctgaggctctgaaggtagctccttccctaagggagctgggcctcctccagaaccga
ctcactgaggcaggcctgcgtttactaagccaaggcctggcttggcccaaatgcaaggtg
cagacactcaggatacagatgcctggcctccaagaggtgatccactacctggtcattgtg
ctccagcagagcccagtcctaaccactctggacctcagtggctgtcagctgcctggcact
gtggtggaacctctgtgttcagccctgaagcaccctaaatgtggcctaaagaccctcagt
ctgacttctgtggagctgactgagaatccactgagagagcttcaagctgtgaagacatta
aagccagatctggccatcatacattcaaaattgggcacacatcctcagcctctgaaggga
tga

DBGET integrated database retrieval system