KEGG   Rattus norvegicus (rat): 171499
Entry
171499            CDS       T01003                                 

Gene name
Crlf2
Definition
(RefSeq) cytokine receptor-like factor 2 precursor
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    171499 (Crlf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171499 (Crlf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    171499 (Crlf2)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL2 receptor family
   171499 (Crlf2)
SSDB
Motif
Pfam: fn3 Toxin_30 Tissue_fac
Other DBs
NCBI-GeneID: 171499
NCBI-ProteinID: NP_604460
RGD: 621078
Ensembl: ENSRNOG00000049828
UniProt: Q6AZ53
Position
14
AA seq 360 aa
MRAVTWAIVAMLLPRVLGAIPTRTPRTGGVGDTLSVAIVCHDLESVEVTWGPGSAHHGLS
ANLSLEFRYGNQVPQPCPHYFLLDSVRAGCVLPMGKGLLEVVLREGGGAKLFSRKKKASA
WLRPRPPWNVTLSWVGDTVAVSCPSHSYPGLEYEVQHRDDFDPEWQSTSAPFCNLTVGGL
DPGRCYDFRVRATPQDFYYGPEARPSKWTGVASLQGVGPTGSCTGPTLPRTPGTPTPPLA
LACGLAVALLTLVLLLALLRMRRVKEALLPGVPDPRGSFPGLFEKHHGNFQAWIADSQAA
VPTVPEQDKDDDVIRPQTKGVETQEEDDVIAPGSPCLGGGALMSVGGASFLMGDSGYTTL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgcgagctgtgacctgggccatcgtggccatgctcctgccgcgggtcttgggggcgatt
ccgacgaggacgccacggacagggggcgtcggtgacaccctctctgttgccattgtttgc
catgacctggagagcgtggaagtcacgtggggcccgggctctgcccaccatgggctgtca
gccaatctcagcctggagttccggtatggaaaccaggtcccccagccctgcccacactac
tttctgttggacagcgtcagagcaggctgtgtcctccccatggggaaggggcttctggag
gtggtgctgcgtgagggaggcggagccaagctgttctcccggaagaagaaggcatcggcc
tggctgaggccccgccctccatggaacgtcaccctgagctgggtaggggacactgttgct
gtttcctgcccctcccactcttaccctgggctggaatatgaggtgcagcacagagatgac
ttcgaccctgaatggcagtcgacctctgcaccattctgcaacctgacagtgggcgggctg
gaccctgggcgctgctacgacttccgggtgcgggcgacgccccaggatttctactatggc
cccgaggcgcggcccagcaagtggacaggcgtggccagcctgcagggagtgggacccaca
ggctcctgcactggccccaccctcccgaggacccccgggacccccaccccacctctcgcc
ctggcctgtggccttgcggtggccctgctcaccctggtgctgctcctggccctgctgcgg
atgcgcagggtgaaggaagccctgctgcctggtgtccccgacccccgcggctccttccct
ggcctcttcgagaaacatcatgggaacttccaggcttggatcgcagattctcaggctgct
gtccctacggtcccagagcaggacaaagatgatgatgtcatccggcctcagaccaagggg
gtggaaactcaggaggaggatgatgtcattgccccggggtccccatgccttgggggaggg
gccctgatgtcggtgggcggggcctcgttcctgatgggagacagcggctacaccaccctg
tga

DBGET integrated database retrieval system