KEGG   Rattus norvegicus (rat): 24946Help
Entry
24946             CDS       T01003                                 

Gene name
F9
Definition
(RefSeq) coagulation factor IX
  KO
K01321  coagulation factor IX (Christmas factor) [EC:3.4.21.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24946 (F9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24946 (F9)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.22  coagulation factor IXa
     24946 (F9)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   24946 (F9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla FXa_inhibition EGF cEGF Trypsin_2 DUF1986 hEGF
Motif
Other DBs
NCBI-GeneID: 24946
NCBI-ProteinID: NP_113728
RGD: 2589
Ensembl: ENSRNOG00000003430
UniProt: P16296
Position
Xq36
AA seq 462 aa AA seqDB search
MADAPGLIPIFLLGYLLSTECAVFLDRENATKILTRPKRYNSGKLEEFVQGNLERECIEE
RCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGICKDDINSYECWCQAGFEGRN
CELDATCSIKNGRCKQFCKNSPDNKIICSCTEGYQLAEDQKSCEPAVPFPCGRVSVAYNS
KKITRAETVFSNTDYGNSTELILDDITNSTILDNLTENSEPINDFTRVVGGENAKPGQIP
WQVILNGEIEAFCGGAIINEKWIVTAAHCLKPGDKIEVVAGEHNIDEKEDTEQRRNVIRT
IPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANKEYTNIFLKFGSGYVSGWGKV
FNKGRQASILQYLRVPLVDRATCLRSTKFSIYNNMFCAGYREGGKDSCEGDSGGPHVTEV
EGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgctccgggtctcatccccatcttccttctgggctatctactcagcactgaa
tgtgcagtttttcttgatcgcgaaaatgccaccaaaattcttacccgtccaaagagatat
aactcagggaaactggaagagtttgttcagggaaaccttgagagagagtgcatagaagaa
agatgcagttttgaagaagcacgagaagtttttgaaaacactgaaaaaactactgaattt
tggaagcagtatgttgatggagatcagtgtgaatcaaatccttgcttaaatggtggaata
tgcaaggatgatattaattcctatgaatgttggtgccaagctggatttgaaggaaggaac
tgtgaattagatgcaacatgtagcattaaaaatggcaggtgtaagcagttttgtaaaaac
agccctgataacaagataatttgttcctgcactgagggataccaacttgcagaagaccag
aagtcctgtgaaccagcagttccattcccatgtggaagagtttctgttgcctacaattct
aaaaagatcacccgtgctgagactgttttttctaataccgactatggaaattccactgaa
ttaatcctggatgacatcaccaacagcaccattcttgataacctcactgaaaatagtgaa
ccaattaatgacttcactcgagttgttggtggagaaaatgcgaaaccaggtcaaatccct
tggcaggtcattctaaatggtgaaattgaggcattctgtggaggcgccatcattaatgaa
aaatggattgtaactgctgcccactgtcttaaacctggtgataaaattgaggttgttgct
ggtgaacataatattgatgagaaggaagacacagaacaaaggagaaatgtgattcgaact
atccctcatcaccagtacaatgcaactattaataagtatagtcatgacattgccttgctg
gaactggataaacctttaatactaaacagctatgtaacacctatctgtgttgccaataag
gaatatacaaatatcttcctcaagtttggttctggttatgtgagtggctgggggaaagtc
ttcaacaaagggagacaggcttccattcttcagtaccttagagttccactggttgaccga
gccacatgccttaggtccacaaaattcagcatctataacaacatgttctgtgcaggttac
cgtgaaggaggcaaagattcatgtgaaggagatagtgggggaccccatgttactgaagta
gaagggacaagtttcttaactggcattattagctggggtgaagaatgtgcaatgaaaggc
aaatatggaatatatactaaggtttccaggtatgtcaactggattaaggaaaaaacaaag
ctaacttaa

DBGET integrated database retrieval system