KEGG   Rattus norvegicus (rat): 25156
Entry
25156             CDS       T01003                                 

Gene name
Vav1, Vav
Definition
(RefSeq) vav guanine nucleotide exchange factor 1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04510  Focal adhesion
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25156 (Vav1)
   04024 cAMP signaling pathway
    25156 (Vav1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25156 (Vav1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25156 (Vav1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    25156 (Vav1)
   04660 T cell receptor signaling pathway
    25156 (Vav1)
   04662 B cell receptor signaling pathway
    25156 (Vav1)
   04664 Fc epsilon RI signaling pathway
    25156 (Vav1)
   04666 Fc gamma R-mediated phagocytosis
    25156 (Vav1)
   04670 Leukocyte transendothelial migration
    25156 (Vav1)
   04062 Chemokine signaling pathway
    25156 (Vav1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25156 (Vav1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    25156 (Vav1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    25156 (Vav1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   25156 (Vav1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CH CAMSAP_CH SH2 SH3_9 C1_1 PH CDC24 LZ3wCH C1_2 PH_16 DUF4335 PH_10
Other DBs
NCBI-GeneID: 25156
NCBI-ProteinID: NP_036891
RGD: 3951
Ensembl: ENSRNOG00000050430
UniProt: Q5BK91
Position
9q12
AA seq 843 aa
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLWPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEDSALGDEDIYSGLSDQIDDTAEEDEDLYDCVENEEAEGDEIYEDLMRS
ESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDMETIFVNI
EELLSVHTHFLKELKDALSGPGATMLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDTTEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLANYGRPKIDGELKITSVERRSKT
DRYAFLLDKALLICKRRGDSYDLKASVNLHSFQVRDDSSGERDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCYRCRAPAHKECLGRVPPCGRQDFSGTMKKDKLHRRAQDKKRNELGLPKMEVCQE
YYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVRPYVHGP
PQDLSVHLWYAGPMERAGAEGILTNRSDGTYLVRQRVKDTAEFAISIKYNVEVKHIKIMT
SEGLYRITEKKAFRGLPELVEFYQQNSLKDCFKSLDTTLQFPYKEPERRAINKPPVGSTK
YFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDYS
EYC
NT seq 2532 nt   +upstreamnt  +downstreamnt
atggagctctggcgacagtgcacccactggctgatccagtgtcgggtgctgcctcccagc
caccgtgtgacctgggagggggcccaggtgtgtgagctggcacaggcactgcgggatggt
gtcctcctgtgtcaactgcttaacaacctgctcccccacgccatcaatctgcgggaagtt
aacttgtggccccagatgtcccagttcctttgtcttaagaacatccgaaccttcctgtct
acttgctgtgagaaattcggcctcaagcgcagcgaactctttgaggcttttgacctcttt
gatgtgcaggactttggaaaggtcatctacaccctgtctgccctgtcatggacacccatt
gcccagaacaaagggatcatgcccttcccaacagaggacagcgccctgggtgatgaagat
atttacagtggcctttcagaccagattgatgacaccgcagaggaagatgaggacctttat
gactgcgtggagaatgaggaggcagagggggacgagatctacgaggacctaatgcgctcg
gagtcggtgcccacacctcccaagatgacagagtacgataagcgctgctgctgcctgcgg
gagatccagcagactgaggagaagtacacagacacactgggctccatccagcagcacttc
atgaagcccctccagcgattcctcaagcctcaagacatggagaccatctttgtcaacatt
gaggagctgctctctgtgcacacccacttcttaaaggaactgaaggatgccctgtctggc
ccgggagcaacgatgctgtatcaggtcttcatcaagtataaggagaggttccttgtttat
ggccgttattgcagtcaggtggagtcagccagcaagcacttggatcaagtggccacagca
cgggaggatgtgcagatgaagctggaggaatgctctcaaagagccaacaatggccgcttc
accctgcgggatctgctgatggtgcctatgcagcgggtgctgaagtatcacctcctcctc
caggagctagtgaaacacacacaggatactacagaaaaggagaacctgcggttggccctg
gacgccatgagggacctggcgcagtgtgtgaatgaggtcaagagggacaatgaaacctta
cggcagatcacaaactttcagctgtccattgagaacctggaccagtctctggccaactat
ggccggcctaagattgacggtgagctcaagattacctcagtggaacggcgctccaagaca
gacaggtatgccttcctgctggacaaagcactgctcatctgtaagcgccgcggggactct
tatgacctcaaggcctcagtgaacctgcacagcttccaagttcgggatgactcttccggg
gagcgggacaacaagaagtggagccacatgttccttctgattgaggatcaaggtgcccag
gggtatgagctgttcttcaagactcgggagctaaaaaagaagtggatggaacagtttgaa
atggccatctccaacatctacccagaaaatgctacagccaatggacatgattttcagatg
ttctcctttgaggagaccacttcctgcaaggcctgccagatgttactcaggggcacattc
taccagggatatcgctgttacaggtgccgtgcacccgcacacaaggagtgtctgggaagg
gtgcctccatgtggccgtcaagatttctcaggaaccatgaagaaggacaagctacatcga
agggcccaggacaagaaaaggaatgaattgggccttcctaagatggaggtgtgtcaggaa
tactacgggatccctcctcctcccggagcctttgggccatttctgcggctcaaccctggg
gacattgtggaactcactaaggcagaggctgaacacaactggtgggagggaagaaataca
gctacgaatgaagtcggctggtttccctgtaacagagttcgtccctacgtccacggccct
ccccaggacctgtctgtgcacctctggtatgcgggccccatggagcgagcaggcgccgag
ggcatcctcaccaaccgctctgatgggacctacctggtgcggcaaagggtgaaagataca
gcggaattcgccatcagcattaagtataatgtggaggtcaagcatattaaaatcatgacg
tcagaggggttgtaccgcatcacagagaagaaggctttccggggcctcccggaactggta
gagttttatcagcagaattccctaaaagattgcttcaagtcgttggacaccaccttgcag
tttccttacaaggaacctgagaggagagccatcaacaagccgccggttggaagcaccaag
tattttggcactgccaaagcccgctacgacttctgtgcccgggaccgatcggaactgtcc
cttaaggagggtgacatcatcaagatcctcaacaagaagggacagcaaggctggtggcgt
ggggagatctatggccggattggctggtttccctctaactatgtggaggaagactattct
gaatactgctga

DBGET integrated database retrieval system