KEGG   Rattus norvegicus (rat): 25268Help
Entry
25268             CDS       T01003                                 

Gene name
Proc
Definition
(RefSeq) protein C
  KO
K01344  protein C (activated) [EC:3.4.21.69]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25268 (Proc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    25268 (Proc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.69  protein C (activated)
     25268 (Proc)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   25268 (Proc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla FXa_inhibition Trypsin_2 EGF DUF1986 hEGF cEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 25268
NCBI-ProteinID: NP_036935
RGD: 3411
Ensembl: ENSRNOG00000014376
UniProt: P31394
Position
18p12
AA seq 461 aa AA seqDB search
MWQFRIFLLFASTWGISGVSAHPDPVFSSSEGAHQVLRVRRANSFLEEVRAGSLERECME
EICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSTPPLDHQCDSPCCGHGTCIDGLGGFSCS
CDKGWEGRFCQQEMGFQDCRVKNGGCYHYCLEETRGRRCRCAPGYELADDHMHCRPTVNF
PCGKLWKRTDKKRKNFKRDIDPEDEELELGPRIVNGTLTKQGDSPWQAILLDSKKKLACG
GVLIHTSWVLTAAHCLESSKKLTVRLGEYDLRRRDPWELDLDIKEVLVHPNYTRSNSDND
IALLRLSQPATLSKTIVPICLPNSGLAQELSQAGQETVVTGWGYQSDKVKDGRRNRTFIL
TFIRIPLAARNDCMQVMNNVVSENMLCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLV
SWGEGCGHLNNYGVYTKVGSYLKWIHSYIGERDVSLKSPKL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagttcagaatcttcctgctgttcgcgtccacctgggggatttctggcgtatca
gcccatcccgacccagtgttctccagcagcgagggtgcccaccaggtgcttcgggtcaga
cgagccaacagcttcctggaggaggtgcgggcaggcagcctggagcgggagtgtatggag
gagatctgtgacttcgaggaggcccaggagattttccagaatgtggaagacacactggcc
ttttggatcaagtacttcgatggtgaccagtgctcaactccgcccttggaccaccaatgc
gacagcccatgctgcggccatggcacatgcatcgacggcctgggcggcttcagctgcagc
tgcgataagggctgggagggcaggttctgtcagcaggagatgggcttccaggactgtcgg
gtgaaaaatggcggctgctaccactactgcctggaggagaccagagggcggcgctgccgt
tgcgccccgggctatgagctggcagatgaccacatgcactgcaggcccaccgtgaatttt
ccgtgtgggaaactgtggaagcggactgacaagaaacgcaagaacttcaaacgggacata
gacccagaagacgaagaactagaactaggtccaaggatagtcaatggaacactaacaaag
cagggtgacagtccctggcaggcgatccttctggactccaagaagaagctagcctgtgga
ggggtgctcatccacacctcctgggtgctgacggcagcccactgtctggagagcagcaag
aagcttaccgtgaggcttggtgagtatgatctgagacgcagggacccctgggagttggac
ctggacatcaaggaggtcctcgtccaccctaactacacccggagcaacagcgacaacgac
atcgccctgctccgcctgtcccagccagccacactctctaaaaccatagtgcccatctgt
ctgccgaacagcggcctggcgcaggagctcagtcaggctggccaggagacggtggtgaca
ggctggggctatcaaagcgacaaagtcaaggatggcagaaggaaccgcacctttattctc
accttcatccgcatccctttggccgctcgaaatgactgcatgcaggtcatgaacaacgtg
gtctcggagaacatgctctgcgccggcatcattggagacacgagagacgcctgcgacggc
gacagtgggggacctatggtggtcttctttcggggtacctggtttctggtgggcctggtg
agctggggtgagggctgtgggcacctcaacaactatggcgtctacaccaaagtgggtagc
tacctcaaatggatccacagctacataggggaaagggatgtttccctgaagagcccgaag
ctgtag

DBGET integrated database retrieval system