KEGG   Rattus norvegicus (rat): 25313Help
Entry
25313             CDS       T01003                                 

Gene name
Egf
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  Jak-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05226  Gastric cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25313 (Egf)
   04015 Rap1 signaling pathway
    25313 (Egf)
   04010 MAPK signaling pathway
    25313 (Egf)
   04012 ErbB signaling pathway
    25313 (Egf)
   04630 Jak-STAT signaling pathway
    25313 (Egf)
   04066 HIF-1 signaling pathway
    25313 (Egf)
   04068 FoxO signaling pathway
    25313 (Egf)
   04072 Phospholipase D signaling pathway
    25313 (Egf)
   04151 PI3K-Akt signaling pathway
    25313 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25313 (Egf)
   04540 Gap junction
    25313 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25313 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25313 (Egf)
   05231 Choline metabolism in cancer
    25313 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25313 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    25313 (Egf)
   05212 Pancreatic cancer
    25313 (Egf)
   05226 Gastric cancer
    25313 (Egf)
   05214 Glioma
    25313 (Egf)
   05218 Melanoma
    25313 (Egf)
   05219 Bladder cancer
    25313 (Egf)
   05215 Prostate cancer
    25313 (Egf)
   05213 Endometrial cancer
    25313 (Egf)
   05224 Breast cancer
    25313 (Egf)
   05223 Non-small cell lung cancer
    25313 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    25313 (Egf)
   05165 Human papillomavirus infection
    25313 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25313 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25313 (Egf)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   25313 (Egf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA EGF cEGF EGF_3 DUF5050 Tr-sialidase_C hEGF
Motif
Other DBs
NCBI-GeneID: 25313
NCBI-ProteinID: NP_036974
RGD: 2542
Ensembl: ENSRNOG00000053979
UniProt: P07522
Position
2q21
AA seq 1133 aa AA seqDB search
MLFSLTFLSVFLKITVLSVTAQQTRNCQSGPLERSGTTTYAAAGPPRFLIFLQGNSIFRI
NTDGTNHQQLVVDAGVSVVMDFHYKEERLYWVDLERQLLQRVFFNGSGQETVCKVDKNVS
GLAINWIDGEILRTDRWKGVITVTDMNGNNSRVLLSSLKRPANILVDPTERLIFWSSVVT
GNLHRADLGGMDVKTLLEAPERISVLILDILDKRLFWAQDGREGSHGYIHSCDYNGGSIH
HIRHQARHDLLTMAIFGDKILYSALKEKAIWIADKHTGKNVVRVNLDPASVPPRELRVVH
LHAQPGTENRAQASDSERCKQRRGQCLYSLSERDPNSDSSACAEGYTLSRDRKYCEDVNE
CALQNHGCTLGCENIPGSYYCTCPTGFVLLPDGKRCHELVACPGNRSECSHDCILTSDGP
LCICPAGSVLGKDGKTCTGCSFSDNGGCSQICLPLSLASWECDCFPGYDLQLDRKSCAAS
MGPQPFLLFANSQDIRHMHFDGTDYKTLLSRQMGMVFALDYDPVESKIYFAQTALKWIER
ANLDGSQRERRITEGVDTPEGLAVDWIGRRIYWTDSGKSVIEGSDLSGKHHQIIIKESIS
RPRGIAVHPKARRLFWTDTGMSPRIESSSLQGSDRTLIASSNLLEPSGIAIDYLTDTLYW
CDTKLSVIEMADLDGSKRRRLTQNDVGHPFSLAVFEDHVWFSDWAIPSVIRVNKRTGQNR
VRLRGSMLKPSSLVVVHPLAKPGADPCLHRNGGCEHICQESLGTAQCLCREGFVKAPDGK
MCLTRKDDQILAGDNADLSKEVASLDNSPKAYVPDDDRTESSTLVAEIMVSGLNYEDDCG
PGGCGSHAHCISEGEAAVCQCLKGFAGDGNLCSDIDECELGSSDCPPTSSRCINTEGGYV
CQCSEGYEGDGIYCLDVDECQQGSHGCSENATCTNTEGGYNCTCAGCPSAPGLPCPDSTS
PSLLGKDGCHWVRNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDL
RWWKLRHADYGQRHDITVVSVCVVALALLLLLGMWGTYYYRTRKQLSESSKKPSEESSSN
VSSNGPDSSGAGVSSGPQPWFVVLEEHQQPKNGRLPAAGTNGAVVEAGLSSSL
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgctgttctcgctcaccttcctgtcggtgtttttaaagattactgtactcagtgtcaca
gcacagcagaccaggaactgtcagtcaggtcctctcgagagaagcgggactaccacgtat
gccgccgccggtcctcccaggttcctgattttcttacaaggaaacagcatctttcggatt
aacacagatggaacaaatcaccagcaattggtggtggatgccggcgtctcagtggtcatg
gattttcattacaaggaagagagactctattgggtggatttagaaagacaacttttgcaa
agagttttctttaatgggtcaggacaagagacagtgtgcaaggtggataagaatgtgtct
gggctggccataaactggatagatggggagattctccggacggaccgatggaagggagtc
atcacagtaacagatatgaacgggaacaattcccgtgttcttctgagttccttaaaacgt
cctgcaaatatattagtggatccaacagagaggttgatattttggtcttcagtggtgact
ggcaaccttcacagagcagatctcgggggtatggatgtaaaaacactgctggaggcacca
gagaggatatcagtgctgattctggatatcctggacaaaaggctcttctgggctcaggac
ggtagagaaggaagccacggttacattcactcctgtgactataacggtggctccatccat
catatcagacatcaagcacggcacgatttgcttactatggccattttcggtgacaagatc
ttatactcagcactgaaagagaaggcgatttggatagccgacaaacacactgggaagaat
gtggttcgagttaacctcgatccagcctctgtgccgccaagagaactgagagtcgtgcac
ctacatgcacagcccgggacagagaaccgtgctcaggcctctgactccgaacgatgcaaa
cagagaagaggacagtgtctctacagtctctctgagcgagaccccaactcagactcgtcg
gcatgcgctgaaggctatacgttaagccgagaccggaagtactgcgaagatgtcaatgag
tgtgccttgcagaatcacggctgtactcttgggtgtgaaaacatccctggatcctattac
tgcacatgccctacaggctttgttctgcttcctgatgggaaacgatgtcacgaacttgtt
gcctgtccaggcaacagatcagagtgtagccatgattgcatcctgacatcagatggtcct
ctgtgcatctgtccagcaggttcagtgctcggaaaagatgggaagacatgcactggttgt
tccttctccgataatggtggatgcagccagatctgccttcctctcagcctagcatcctgg
gaatgtgattgctttcctgggtacgacctacaattggaccgaaagagctgtgcagcttcc
atgggaccgcagccatttttactgtttgcaaattcccaggacatacgacacatgcatttt
gatggaacagactacaaaactctgctcagccggcagatgggaatggtttttgccttggat
tatgaccccgtggaaagcaagatatattttgcacagacagccctgaagtggatagagagg
gctaatctggatggctcccagcgagaaagacggatcacggaaggagtagacacgccagaa
ggtcttgccgtggactggattggccggagaatctactggacggacagtgggaagtctgtc
attgaagggagtgatttgagcgggaagcatcatcaaataatcatcaaagagagcatctca
aggccacgaggaatagctgtgcatccaaaggccaggagactattctggacggacacgggg
atgtctccgcggattgaaagctcttcccttcaaggttctgaccggacgctgatagccagc
tctaatctactggaacccagtggaatcgcgattgactacttaacagacactttgtactgg
tgtgacaccaagctgtctgtgattgaaatggccgatctagatggttccaaacgccgcaga
cttacccagaacgatgtaggtcacccattctctctagctgtgtttgaggatcacgtgtgg
ttctcggattgggctatcccatcggtaataagggtgaacaagaggactggtcaaaacagg
gtacgtctccgaggcagcatgctgaagccctcgtcactggttgtggtccacccattggca
aaaccaggtgcagacccctgcttacacaggaatggaggctgtgaacacatctgccaagag
agcctgggcacggctcagtgtctgtgtcgggaaggattcgtgaaggccccagatgggaaa
atgtgtctcactcggaaggatgatcagatactggccggtgacaatgctgatcttagtaaa
gaggtggcatcgttggacaactcccctaaggcttatgtaccagacgatgataggacagag
tcctccacactagtggctgagatcatggtgtcagggctgaactatgaagatgactgcggc
cctggtgggtgtggcagccatgcccactgtatttcagagggagaggcagctgtgtgtcag
tgtttgaaaggatttgctggcgatggaaacctgtgttctgatatagacgaatgtgagctg
ggtagctcagactgtcctcccacctcgtccaggtgcatcaacaccgaaggtggctatgtc
tgccaatgctcagaaggctacgagggagatgggatctactgtctcgacgttgatgagtgc
cagcaggggtcgcacggctgcagcgagaatgccacctgcaccaacacggagggaggctac
aactgcacctgtgcaggctgcccatcagcacctggactgccttgccctgactctacctca
ccctctctccttggaaaagatggctgccactgggtccgaaacagtaacacaggatgcccg
ccgtcgtacgatgggtactgcctcaatggtggcgtgtgcatgtatgttgaatccgtggac
cgctacgtgtgcaactgtgtcattggctatattggagaacgatgtcagcaccgagactta
cgttggtggaagctgcgccatgctgactacgggcagaggcacgacatcactgtggtgtct
gtctgtgtggtggcgctggccctgctgctcctcttagggatgtgggggacttactactac
aggactcggaagcagctatcagagagctcaaagaagccttccgaagagtcaagcagcaac
gtgagcagtaacgggcctgacagcagcggggctggggtgtcttctggtccccaaccttgg
tttgtggtcctagaggaacaccaacagcccaagaatgggcgtctgcctgccgctggcacg
aacggcgcagtagtagaggctggcctgtcttcctccctgtaa

DBGET integrated database retrieval system