KEGG   Rattus norvegicus (rat): 25356Help
Entry
25356             CDS       T01003                                 

Gene name
Cntn2, TAG-1, TAG-564, TAG1, Tax
Definition
(RefSeq) contactin 2
  KO
K06760  contactin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    25356 (Cntn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    25356 (Cntn2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25356 (Cntn2)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  Contactins
   25356 (Cntn2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  25356 (Cntn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set ig Ig_2 fn3 V-set Ig_6 Ig_5 Ig_4 Pur_ac_phosph_N Izumo-Ig C2-set C2-set_2 Interfer-bind Nucleoporin_N
Motif
Other DBs
NCBI-GeneID: 25356
NCBI-ProteinID: NP_037016
RGD: 3821
Ensembl: ENSRNOG00000009033
UniProt: P22063
Position
13q13
AA seq 1040 aa AA seqDB search
MGTHARKKASLLLLVLATVALVSSPGWSFAQGTPATFGPIFEEQPIGLLFPEESAEDQVT
LACRARASPPATYRWKMNGTDMNLEPGSRHQLMGGNLVIMSPTKTQDAGVYQCLASNPVG
TVVSKEAVLRFGFLQEFSKEERDPVKTHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIP
TDGRHFVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDPRLFA
PSIKARFPPETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWATAEPTLQIPSVSF
EDEGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPMV
RWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPD
FRQNPVRRLIPAARGGEISILCQPRAAPKATILWSKGTEILGNSTRVTVTSDGTLIIRNI
SRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINVGDNLTLQCHASHDPTM
DLTFTWTLDDFPIDFDKPGGHYRRASAKETIGDLTILNAHVRHGGKYTCMAQTVVDGTSK
EATVLVRGPPGPPGGVVVRDIGDTTVQLSWSRGFDNHSPIAKYTLQARTPPSGKWKQVRT
NPVNIEGNAETAQVLGLMPWMDYEFRVSASNILGTGEPSGPSSKIRTKEAVPSVAPSGLS
GGGGAPGELIINWTPVSREYQNGDGFGYLLSFRRQGSSSWQTARVPGADAQYFVYGNDSI
QPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPAKVWAKGSSSSEMNVSWEPVLQ
DMNGILLGYEIRYWKAGDNEAAADRVRTAGLDTSARVTGLNPNTKYHVTVRAYNRAGTGP
ASPSADAMTVKPPPRRPPGNISWTFSSSSLSLKWDPVVPLRNESTVTGYKMLYQNDLHPT
PTLHLTSKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVESAAARPA
HPGPAFSCMVILMLAGYQKL
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atggggacacacgccaggaaaaaggcaagcttgctgctgctggtgctggccacagtggcc
ctggtctcctctccaggatggagttttgcccagggaaccccagctacctttggacccatc
ttcgaagagcaacccattggcctgctattcccagaggagtctgcagaggatcaggtgaca
ctggcgtgccgtgcccgtgctagccctccagccacctacaggtggaagatgaatggcaca
gatatgaacctggaacctggctcccgtcaccagctgatggggggcaacctggtcatcatg
agccccaccaagacacaggatgctggtgtctaccagtgcctagcctccaacccagtaggc
actgtggtcagcaaggaggctgtcctccgctttggctttctacaggaattctccaaggag
gagagagaccctgtgaaaacccatgagggctggggagtgatgctgccctgtaacccgcct
gcccattacccaggtttgtcctaccgctggctcctcaacgagttccccaacttcatccca
acggatgggcgacacttcgtgtcccagactacaggaaacctgtacatcgcccggaccaat
gcctcagacctgggcaactactcttgtttggctaccagccacatggacttttccaccaag
agtgtcttcagcaaatttgcgcagctcaacctggctgcggaagatccccgactcttcgct
cccagtatcaaagctcggttccccccggagacctacgcactagttgggcagcaagtcacc
ctggagtgctttgcctttgggaacccggttccccggatcaagtggcgcaaagtggatggt
tccttgtcccctcagtgggccacagctgagcccaccctgcagatccccagcgtgagcttt
gaagacgagggtacctatgaatgtgaggcagagaactccaagggtcgtgacaccgtccag
ggacgcatcatcgtgcaagctcagcctgagtggctaaaggtgatctcagacacagaggcc
gacattggctccaacttacgttggggctgtgcagcagcaggcaaaccccggcccatggtg
cgctggctgagaaacggggaacctctggcctcccagaaccgggtggaggtcttggctggg
gacctgcgattctctaagctgagcctggaggactctggcatgtaccagtgtgtggctgaa
aacaagcatggcaccatctatgccagtgctgagctggctgtacaagctctggccccagac
ttcaggcagaaccctgtgagacggctgatccctgcagctcgaggcggagagatcagcatc
ctgtgccagcctcgcgcagccccaaaagctacaatactttggagcaagggtactgagatt
ttggggaacagtaccagagtgactgtcacttccgatggcaccttgatcatcagaaacatc
agccgatccgatgaaggcaaatatacctgctttgctgagaacttcatgggcaaagccaac
agtaccgggatcctgtccgtgcgcgatgcaaccaagatcaccctggctccctccagtgct
gacatcaacgtgggtgacaacctgaccctacaatgtcatgcctcgcacgaccccactatg
gacctcacgttcacctggaccctggatgatttccctattgactttgataagcctggaggt
cactaccggagagccagtgcgaaggagaccattggggacctgactatcctcaacgcccac
gtacgccatggagggaagtacacatgcatggcccagactgtggtagatggtacatccaag
gaggccacagtcctggtccgaggtcccccaggtcccccagggggtgtggtggtgagagac
atcggagacaccaccgttcagcttagctggagtcgtggctttgacaaccacagccccatt
gccaagtacacgctgcaagctcgtactccaccctcggggaaatggaagcaggttcggacc
aatcctgtgaatatcgagggtaatgccgagactgcccaggtgctgggtctcatgccttgg
atggactatgagtttcgggtttcagctagcaacatcttgggcactggggagcccagcggg
ccctccagcaaaatccgcactaaggaagcagtcccctcagtggcaccatcgggactcagt
ggagggggaggagcccctggagagctcatcatcaactggactcccgtgtcacgggagtac
cagaacggagacggcttcggctacctgctgtccttccgcaggcaaggcagctccagctgg
cagactgcccgggtgcctggcgctgatgcgcagtacttcgtctacggcaatgacagcatc
cagccctacacaccctttgaggtcaagatccgaagctacaatcgccggggggatgggccc
gagagcctcactgcgttagtgtactcagcagaggaagagcccagggtggcccctgccaag
gtctgggccaaggggtcctcatcttcagagatgaacgtgagctgggagcctgtgctacaa
gacatgaacggcattctcctgggatatgagattcgctactggaaagccggggacaacgaa
gcagccgctgaccgagtgaggacagcagggctagacaccagtgcccgagtcactggcctg
aaccccaacaccaaataccacgtaactgtgagggcctacaaccgggccggcactggaccc
gctagcccttcagctgatgccatgaccgtgaagcccccgccacggagacctcctggcaac
atctcctggactttctcaagctccagtctcagccttaagtgggaccctgtggttcctctc
cgaaatgaatctacggtcactggctacaagatgctgtatcagaatgatttgcacccaact
cctacgctccacctcaccagcaagaactggatagaaataccagtacccgaagacattggc
cacgctctggtacagattcgaaccacagggcctggaggggatgggatccccgcagaagtc
cacattgtgagaaatggaggcacaagcatgatggtggagagcgccgccgcccgccctgcc
catcccggacctgcgttctcctgcatggtgatattgatgctcgctggctaccagaagctc
tga

DBGET integrated database retrieval system