KEGG   Rattus norvegicus (rat): 25393
Entry
25393             CDS       T01003                                 

Symbol
Bcan
Name
(RefSeq) brevican core protein isoform 1 precursor
  KO
K06795  brevican
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    25393 (Bcan)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25393 (Bcan)
   04091 Lectins [BR:rno04091]
    25393 (Bcan)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   25393 (Bcan)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   25393 (Bcan)
Lectins [BR:rno04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   25393 (Bcan)
SSDB
Motif
Pfam: Xlink Lectin_C V-set EGF Sushi hEGF EGF_3 I-set EGF_2 Izumo-Ig ig Ig_2 Ig_3 EGF_CA
Other DBs
NCBI-GeneID: 25393
NCBI-ProteinID: NP_001028837
RGD: 2194
Ensembl: ENSRNOG00000018798
UniProt: P55068 G3V8G4
Position
2
AA seq 883 aa
MIPLLLSLLAALVLTQAPAALADDLKEDSSEDRAFRVRIGAAQLRGVLGGALAIPCHVHH
LRPPPSRRAAPGFPRVKWTFLSGDREVEVLVARGLRVKVNEAYRFRVALPAYPASLTDVS
LVLSELRPNDSGVYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACAR
IGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQNPREACYGDMDGYPGVRNYGVVG
PDDLYDVYCYAEDLNGELFLGAPPGKLTWEEARDYCLERGAQIASTGQLYAAWNGGLDRC
SPGWLADGSVRYPIITPSQRCGGGLPGVKTLFLFPNQTGFPSKQNRFNVYCFRDSAHPSA
FSEASSPASDGLEAIVTVTEKLEELQLPQEAVESESRGAIYSIPITEDGGGGSSTPEDPA
EAPRTPLESETQSVAPPTGSSEEEGEALEEEERFKDTETPKEEKEQENLWVWPTELSSPL
PTGLETEHSLSQVSPPAQAVLQLGASPSPRPPRVHGPPAETLQPPREGSLTSTPDGAREV
AGETGSPELSGVPRESEEAGSSSLEDGPSLLPATWAPVGTRELETPSEEKSGRTVLTGTS
VQAQPVLPTDSASRGGVAVAPSSGDCIPSPCHNGGTCLEEKEGFRCLCLPGYGGDLCDVG
LHFCSPGWEAFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQW
IGLNDRTIEGDFLWSDGAPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHL
SYTCKMGLVSCGPPPQLPLAQIFGRPRLRYAVDTVLRYRCRDGLAQRNLPLIRCQENGLW
EAPQISCVPRRPARALRSMTAPEGPRGQLPRQRKALLTPPSSL
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgatcccattgcttctgtccctgctggcagctctggtcctgacccaagcccctgcagcc
ctcgctgatgacctgaaagaagacagctcagaggatcgagcctttcgggtgcgcatcggt
gccgcgcagctgcggggtgtgctgggcggtgccctggccatcccatgccacgtccaccac
ctgaggccgccgcccagccgccgggccgcgccgggctttccccgagtcaaatggaccttc
ctgtccggggaccgggaggtggaggtgctggtggcgcgcgggctgcgcgtcaaggtaaac
gaagcctatcggttccgcgtggcgctgcctgcctaccccgcatcgctcacagatgtgtct
ttagtattgagcgaactgcggcccaatgattccggggtctatcgctgcgaggtccagcac
ggtatcgacgacagcagtgatgctgtggaagtcaaggtcaaaggggtcgtcttcctctac
cgagagggctctgcccgctatgctttctccttcgctggagcccaggaagcctgtgctcgc
atcggagcccgaattgccacccctgagcagctgtatgctgcctacctcggcggctatgaa
cagtgtgatgctggctggctgtccgaccaaaccgtgaggtaccccatccagaacccacga
gaagcctgttatggagacatggatggctaccctggagtgcggaattacggagtggtgggt
cctgatgatctctacgatgtctactgttatgccgaagacctaaatggagaactgttccta
ggtgcccctcccggcaagctgacgtgggaggaggctcgggactactgtctggaacgcggt
gctcagatcgctagcacgggccagctatacgcggcatggaatggcggcttggacagatgt
agccctggctggctggctgatggcagtgtgcggtaccccatcatcacgcccagccaacgc
tgtgggggaggcctgccaggagtcaagaccctcttcctctttcccaaccagactggcttc
cccagcaagcagaaccgcttcaatgtctactgcttccgagactctgcccatccctctgcc
ttctctgaggcctccagcccagcctctgatggactagaggccattgtcacagtgacagag
aagctggaggaactgcagttgcctcaggaagctgtggagagcgagtctcgtggggcgatc
tactccatccccatcacagaagatgggggaggaggaagctctaccccagaagacccagca
gaggcccccaggactcctctagaatcagaaacccaatccgttgcaccacctaccgggtcc
tcagaagaggaaggcgaagccctggaggaagaagaaagattcaaagacacagagactccg
aaggaagagaaggagcaggagaacctgtgggtgtggcccacggagctcagcagccctctc
cctactggcttggaaacagagcactcactctcccaggtgtccccaccagcccaggcagtt
ctacagctgggtgcatcaccttctcccaggcctccaagggtccatggaccgcctgcagag
actttgcaacccccaagggagggaagcctcacatctactccagatggggcaagagaagta
gcgggggaaactgggagccctgagctctctggggttcctcgagaaagcgaggaggcagga
agctccagcttggaggatggcccttccctccttccagcgacatgggcccctgtgggtacc
agggagctggagaccccctcagaagagaagtctggaagaactgttctgacaggcacatca
gtgcaggcccagccagtgctgcccaccgacagtgccagccgaggtggagtggctgtggct
ccctcatcaggtgactgtatccccagcccctgccacaatggtgggacatgcttggaggag
aaggagggtttccgctgcctctgtttgccaggctatgggggggacctgtgcgatgttggc
ctccacttctgcagcccgggctgggaggccttccagggtgcctgctacaagcacttttcc
acacgaaggagttgggaggaggcagaaagccagtgccgagcgctaggggctcatctgacc
agcatctgcacccctgaggagcaggactttgtcaacgatcgatacagggagtaccagtgg
attgggctcaatgacaggaccatcgagggtgacttcctgtggtcagatggtgcccctctg
ctctatgaaaactggaaccctgggcagcctgacagctacttcctgtctggggagaactgt
gtggtcatggtgtggcatgaccagggacagtggagtgatgtaccctgcaactaccaccta
tcctacacctgcaagatggggcttgtgtcatgtggacctccaccacagctgcccctggct
caaatatttggtcgccctcggctgcgctacgcggtggacactgtgcttcgatatcggtgc
cgagacgggctggcccagcgcaacttgccgttgatccgctgccaggagaatgggctttgg
gaggcccctcagatttcttgcgtgccccgaagacctgcccgtgctctccgctcaatgacc
gccccagaaggaccacggggacagctcccgaggcagaggaaagcactgttgacacctccc
tccagtctctag

DBGET integrated database retrieval system