KEGG   Rattus norvegicus (rat): 25482
Entry
25482             CDS       T01003                                 

Gene name
Mras
Definition
(RefSeq) ras-related protein M-Ras
  KO
K07831  Ras-related protein M-Ras
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04218  Cellular senescence
rno04371  Apelin signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25482 (Mras)
   04014 Ras signaling pathway
    25482 (Mras)
   04015 Rap1 signaling pathway
    25482 (Mras)
   04371 Apelin signaling pathway
    25482 (Mras)
   04072 Phospholipase D signaling pathway
    25482 (Mras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    25482 (Mras)
   04137 Mitophagy - animal
    25482 (Mras)
  09143 Cell growth and death
   04218 Cellular senescence
    25482 (Mras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25482 (Mras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    25482 (Mras)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25482 (Mras)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    25482 (Mras)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    25482 (Mras)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N AAA_16
Other DBs
NCBI-GeneID: 25482
NCBI-ProteinID: NP_001375430
RGD: 3111
Ensembl: ENSRNOG00000014060
Position
8
AA seq 208 aa
MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP
MILVANKVDLMHLRKITRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVP
EKNQKKKKKTKWRGDRATGTHKLQCVIL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcgaccagcgctgttcccagtgacaaccttcccacatataaactggtagtggtggga
gatggcggtgtgggcaagagtgctctcactattcagtttttccagaagatcttcgtgcct
gactacgaccccaccattgaagactcctacctgaagcatacagagatcgacaatcaatgg
gccatcttggacgttctggacacagctgggcaggaggagttcagtgccatgcgggagcaa
tacatgcgcacaggggatggcttcctcattgtctactctgtcaccgacaaggccagcttc
gagcacgtggaccgcttccaccagctcattctgcgtgtcaaggacagggagtcattccca
atgatcctcgtggccaacaaagtggacctgatgcacctaaggaaaatcaccagggaccaa
ggaaaagaaatggcgaccaaatacaatatcccatatatagaaaccagtgccaaggacccg
cctctcaacgtggacaaaaccttccatgacctagttagagtaattaggcaacaggttcca
gagaaaaaccagaagaagaaaaagaagacaaaatggcgaggggacagggccaccggcact
cacaaactacagtgtgtcatcttgtga

DBGET integrated database retrieval system